Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.8e-16

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.500 1.8e-16

Synonym

Accession O75200 E7ERT9
Symbols NPIPL1
A-575C2.4
A-761H5.5

Gene

AA Sequence

MRLRFWLLIWLLLGFISHQPTPVINSLAVYRHRETDFGVGVRDHPGQHGKTPSPQKLDNLIIIIIGFLRR      1 - 70
YTFNVLFCTSCLCVSFLKTIFWSRNGHDGSMDVQQRAWRSNRSRQKGLRSICMHTKKRVSSFRGNKIGLK     71 - 140
DVITLRRHVETKVRAKIRKRKVTTKINRHDKINGKRKTARKQKMFQRAQELRRRAEDYHKCKIPPSARKP    141 - 210
LCNWVRMAAAEHCHSSGLPYWLYLTAETLKNRMGRQPPPPTQQHSITDNSLSLKTPPECLLTPLPPSVDD    211 - 280
NIKECPLAPLPPSPLPPSVDDNLKECLFVPLPPSPLPPSVDDNLKECLFVPLPPSPLPPSVDDNLKTPPL    281 - 350
ATQEAEVEKPPKPKRWRVDEVEQSPKPKRQREAEAQQLPKPKRRRLSKLRTRHCTQAWAIRINP          351 - 414
//

Text Mined References (3)

PMID Year Title