Property Summary

NCBI Gene PubMed Count 20
PubMed Score 6.30
PubTator Score 133.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.300 8.1e-04
Astrocytoma, Pilocytic -1.400 4.4e-07
atypical teratoid / rhabdoid tumor -1.100 1.5e-03
Breast cancer 2.000 4.1e-02
ependymoma -1.300 1.9e-08
glioblastoma -1.400 5.9e-04
intraductal papillary-mucinous carcinoma... 1.200 2.1e-03
intraductal papillary-mucinous neoplasm ... 1.600 3.4e-03
lung cancer 1.100 4.5e-02
malignant mesothelioma 1.200 9.9e-07
ovarian cancer 2.300 1.6e-07
Pick disease -1.900 4.0e-05
progressive supranuclear palsy -1.100 1.3e-02
psoriasis -1.300 5.5e-03
subependymal giant cell astrocytoma -1.542 4.2e-02

Gene RIF (9)

AA Sequence

MSVAFASARPRGKGEVTQQTIQKMLDENHHLIQCILEYQSKGKTAECTQYQQILHRNLVYLATIADSNQN      1 - 70
MQSLLPAPPTQNMNLGPGALTQSGSSQGLHSQGSLSDAISTGLPPSSLLQGQIGNGPSHVSMQQTAPNTL     71 - 140
PTTSMSISGPGYSHAGPASQGVPMQGQGTIGNYVSRTNINMQSNPVSMMQQQAATSHYSSAQGGSQHYQG    141 - 210
QSSIAMMGQGSQGSSMMGQRPMAPYRPSQQGSSQQYLGQEEYYGEQYSHSQGAAEPMGQQYYPDGHGDYA    211 - 280
YQQSSYTEQSYDRSFEESTQHYYEGGNSQYSQQQAGYQQGAAQQQTYSQQQYPSQQSYPGQQQGYGSAQG    281 - 350
APSQYPGYQQGQGQQYGSYRAPQTAPSAQQQRPYGYEQGQYGNYQQ                            351 - 396
//

Text Mined References (22)

PMID Year Title