Property Summary

NCBI Gene PubMed Count 24
PubMed Score 5.67
PubTator Score 11.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.009 0.000
astrocytoma 1.400 0.001
diabetes mellitus -1.100 0.001

Synonym

Accession O75150 Q6AHZ6 Q6N005 Q7L3T6 Q8N615 Q96T18 Q9BSV9 Q9HC82 BRE1-B
Symbols BRE1B
RBP95
STARING

Gene

Gene RIF (7)

PMID Text
22354749 We show that Bre1 (human BRE1A/B (RNF20/40) and mouse Bre1a/b (Rnf20/40)) acts as an important suppressor of chromosomal instability
22155569 our results suggest that RNF20 and RNF40, either via ubiquitylation of H2B or other targets, are coupled to the proliferation of prostate cancer cells.
22031019 RNF40 cooperates with SUPT16H to induce dynamic changes in chromatin structure during DNA double-strand break repair.
21827756 Studies indicate that H2B monoubiquitylation is driven primarily by an E3 ubiquitin ligase composed of the two RING finger proteins RNF20 and RNF40.
20738173 the observed defects in the radiation response of Bre1a/b-deficient cells
16307923 Formation of trimeric complex UbcH6 and RNF20/40 with PAF stimulates histone 2B monoubiquitination activity in vitro
12121982 Functional Analysis of the rat counterpart

AA Sequence

MSGPGNKRAAGDGGSGPPEKKLSREEKTTTTLIEPIRLGGISSTEEMDLKVLQFKNKKLAERLEQRQACE      1 - 70
DELRERIEKLEKRQATDDATLLIVNRYWAQLDETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPE     71 - 140
PGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASDRLQRRVEELC    141 - 210
QRVYSRGDSEPLSEAAQAHTRELGRENRRLQDLATQLQEKHHRISLEYSELQDKVTSAETKVLEMETTVE    211 - 280
DLQWDIEKLRKREQKLNKHLAEALEQLNSGYYVSGSSSGFQGGQITLSMQKFEMLNAELEENQELANSRM    281 - 350
AELEKLQAELQGAVRTNERLKVALRSLPEEVVRETGEYRMLQAQFSLLYNESLQVKTQLDEARGLLLATK    351 - 420
NSHLRHIEHMESDELGLQKKLRTEVIQLEDTLAQVRKEYEMLRIEFEQNLAANEQAGPINREMRHLISSL    421 - 490
QNHNHQLKGDAQRYKRKLREVQAEIGKLRAQASGSAHSTPNLGHPEDSGVSAPAPGKEEGGPGPVSTPDN    491 - 560
RKEMAPVPGTTTTTTSVKKEELVPSEEDFQGITPGAQGPSSRGREPEARPKRELQEREGPSLGPPPVASA    561 - 630
LSRADREKAKVEETKRKESELLKGLRAELKKAQESQKEMKLLLDMYKSAPKEQRDKVQLMAAERKAKAEV    631 - 700
DELRSRIRELEERDRRESKKIADEDALRRIRQAEEQIEHLQRKLGATKQEEEALLSEMDVTGQAFEDMQE    701 - 770
QNGRLLQQLREKDDANFKLMSERIKANQIHKLLREEKDELGEQVLGLKSQVDAQLLTVQKLEEKERALQG    771 - 840
SLGGVEKELTLRSQALELNKRKAVEAAQLAEDLKVQLEHVQTRLREIQPCLAESRAAREKESFNLKRAQE    841 - 910
DISRLRRKLEKQRKVEVYADADEILQEEIKEYKARLTCPCCNTRKKDAVLTKCFHVFCFECVRGRYEARQ    911 - 980
RKCPKCNAAFGAHDFHRIYIS                                                     981 - 1001
//

Text Mined References (29)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22354749 2012 Deficiency in mammalian histone H2B ubiquitin ligase Bre1 (Rnf20/Rnf40) leads to replication stress and chromosomal instability.
22155569 2012 Histone H2B ubiquitin ligases RNF20 and RNF40 in androgen signaling and prostate cancer cell growth.
22031019 2011 The H2B ubiquitin ligase RNF40 cooperates with SUPT16H to induce dynamic changes in chromatin structure during DNA double-strand break repair.
21827756 2011 RNF20-RNF40: A ubiquitin-driven link between gene expression and the DNA damage response.
21329877 2011 WAC, a functional partner of RNF20/40, regulates histone H2B ubiquitination and gene transcription.
21269460 2011 Initial characterization of the human central proteome.
More...