Property Summary

NCBI Gene PubMed Count 29
Grant Count 40
R01 Count 25
Funding $3,334,542.87
PubMed Score 24.08
PubTator Score 18.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.900 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.200 0.001
intraductal papillary-mucinous neoplasm ... 1.100 0.005
lung cancer 1.100 0.003

Gene RIF (11)

PMID Text
26299944 Structure of the human Atg13-Atg101 HORMA heterodimer in the ULK1 complex that controls autophagy has been described.
24290141 Specific affinity of the LC3 isoforms to the Atg13 LC3-interacting region is required for proper autophagosome formation.
21475306 In response to DNA damage, ULK1 and ULK2 are upregulated by p53. The upregulation of ULK1 (ULK2)/ATG13 complex by p53 is necessary for the sustained autophagy activity induced by DNA damage.
19690328 Studies elucidated the inhibitory mechanism in which mTORC1 phosphorylates the autophagy regulatory complex containing unc-51-like kinase 1 (ULK1), the mammalian Atg13 protein, and focal adhesion kinase interacting protein of 200 kD (FIP200).
19597335 These data suggest that Atg101 is a novel Atg protein that functions together with ULK, Atg13 and FIP200.
19287211 The identification of the novel protein, Atg101, and the validation of Atg13 and Atg101 as ULK1-interacting proteins, suggests an Atg1 complex is involved in the induction of macroautophagy in mammalian cells.
19258318 ATG13 and ULK1 are phosphorylated by the mTOR pathway in a nutrient starvation-regulated manner, indicating that the ULK1.ATG13.FIP200 complex acts as a node for integrating incoming autophagy signals into autophagosome biogenesis.
19225151 The ULK-Atg13-FIP200 complexes are direct targets of mTOR and important regulators of autophagy in response to mTOR signaling.
19211835 mTORC1 suppresses autophagy through direct regulation of the approximately 3-MDa ULK1-Atg13-FIP200 complex.
18936157 The functions of ULK1 and ULK2 are controlled by autophosphorylation and conformational changes involving exposure of the C-terminal domain and interaction with the putative human homologue of Atg13.
More...

AA Sequence

METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALA      1 - 70
GQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRL     71 - 140
SRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGI    141 - 210
IIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGS    211 - 280
ADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTE    281 - 350
TVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETE    351 - 420
SPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAE    421 - 490
DLDSLPEKLAVHEKNVREFDAFVETLQ                                               491 - 517
//

Text Mined References (39)

PMID Year Title
26299944 2015 Structure of the Human Atg13-Atg101 HORMA Heterodimer: an Interaction Hub within the ULK1 Complex.
26236954 2015 The mammalian autophagy initiator complex contains 2 HORMA domain proteins.
24290141 2014 Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23392225 2013 FIP200 regulates targeting of Atg16L1 to the isolation membrane.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23043107 2012 ATG8 family proteins act as scaffolds for assembly of the ULK complex: sequence requirements for LC3-interacting region (LIR) motifs.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
More...