Property Summary

NCBI Gene PubMed Count 34
PubMed Score 28.77
PubTator Score 18.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 3.5e-07
intraductal papillary-mucinous neoplasm ... 1.100 4.6e-03
lung cancer 1.100 2.9e-03
medulloblastoma, large-cell -1.200 9.1e-04
psoriasis 1.900 3.5e-05

 GO Function (1)

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (13)

AA Sequence

METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALA      1 - 70
GQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRL     71 - 140
SRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGI    141 - 210
IIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGS    211 - 280
ADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTE    281 - 350
TVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETE    351 - 420
SPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAE    421 - 490
DLDSLPEKLAVHEKNVREFDAFVETLQ                                               491 - 517
//

Text Mined References (45)

PMID Year Title