Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.06
PubTator Score 7.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.394 0.004
malignant mesothelioma -2.100 0.000
oligodendroglioma 1.500 0.030
cutaneous lupus erythematosus -1.200 0.012
astrocytoma 1.800 0.003
osteosarcoma 2.786 0.000
ependymoma 2.000 0.000
glioblastoma 2.800 0.000
medulloblastoma 2.100 0.000
atypical teratoid / rhabdoid tumor 2.700 0.000
medulloblastoma, large-cell 3.100 0.000
primitive neuroectodermal tumor 1.900 0.000
acute quadriplegic myopathy 1.145 0.000
diabetes mellitus -1.100 0.001
Breast cancer 2.500 0.025
pediatric high grade glioma 2.200 0.000
pilocytic astrocytoma 2.400 0.000
subependymal giant cell astrocytoma 1.491 0.002
lung adenocarcinoma 1.060 0.026
Pick disease 1.100 0.008
ovarian cancer 2.500 0.000
Down syndrome 1.400 0.002

Synonym

Accession O75131 A8KA47 Q8IYA1
Symbols CPN3
PRO1071

Gene

PANTHER Protein Class (1)

Gene RIF (10)

PMID Text
26719032 Copine3 binding to ErbB2 increases when Jab1 is overexpressed in SKBr3 breast cancer cells. Copine3 and Jab1 binding regulates the ErbB2 signaling pathway.
23713811 our results indicate that CPNE3 could play a critical role in NSCLC metastasis.
23125841 Tandem affinity purification and mass spectrometry analysis identify copine III (CPNE3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify copine III (CPNE3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify copine III (CPNE3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify copine III (CPNE3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23062752 This study demonistrated that dysregulation of cpne3 3'UTR in brain of patient with schizophrenia.
20010870 Data suggest that Copine-III is a novel player in the regulation of ErbB2-dependent cancer cell motility.
18264096 Susceptibility genes CPNE3, IL16 and CDH13 with moderate effects associated with susceptibility to prostate cancer.
18264096 Genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAQCVTKVALNVSCANLLDKDIGSKSDPLCVLFLNTSGQQWYEVERTERIKNCLNPQFSKTFIIDYYFE      1 - 70
VVQKLKFGVYDIDNKTIELSDDDFLGECECTLGQIVSSKKLTRPLVMKTGRPAGKGSITISAEEIKDNRV     71 - 140
VLFEMEARKLDNKDLFGKSDPYLEFHKQTSDGNWLMVHRTEVVKNNLNPVWRPFKISLNSLCYGDMDKTI    141 - 210
KVECYDYDNDGSHDLIGTFQTTMTKLKEASRSSPVEFECINEKKRQKKKSYKNSGVISVKQCEITVECTF    211 - 280
LDYIMGGCQLNFTVGVDFTGSNGDPRSPDSLHYISPNGVNEYLTALWSVGLVIQDYDADKMFPAFGFGAQ    281 - 350
IPPQWQVSHEFPMNFNPSNPYCNGIQGIVEAYRSCLPQIKLYGPTNFSPIINHVARFAAAATQQQTASQY    351 - 420
FVLLIITDGVITDLDETRQAIVNASRLPMSIIIVGVGGADFSAMEFLDGDGGSLRSPLGEVAIRDIVQFV    421 - 490
PFRQFQNAPKEALAQCVLAEIPQQVVGYFNTYKLLPPKNPATKQQKQ                           491 - 537
//

Text Mined References (25)

PMID Year Title
26719032 2016 Direct binding of Copine3 with Jab1 activates downstream ErbB2 signaling and motility in SKBr3 breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23713811 2013 Quantitative proteomic analysis identifies CPNE3 as a novel metastasis-promoting gene in NSCLC.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23062752 2012 Transcriptomic analysis of postmortem brain identifies dysregulated splicing events in novel candidate genes for schizophrenia.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
21087455 2010 Copines-1, -2, -3, -6 and -7 show different calcium-dependent intracellular membrane translocation and targeting.
More...