Property Summary

NCBI Gene PubMed Count 22
PubMed Score 10.44
PubTator Score 7.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute quadriplegic myopathy 1.145 3.2e-05
adult high grade glioma 2.100 1.7e-03
astrocytoma 1.100 2.1e-13
Astrocytoma, Pilocytic 2.400 1.5e-06
atypical teratoid / rhabdoid tumor 2.700 8.7e-08
Breast cancer 2.500 2.5e-02
cutaneous lupus erythematosus -1.200 1.2e-02
diabetes mellitus -1.100 1.3e-03
Down syndrome 1.400 2.0e-03
ependymoma 2.000 1.0e-07
glioblastoma 1.500 1.0e-03
group 3 medulloblastoma 1.500 3.1e-03
lung adenocarcinoma 1.060 2.6e-02
malignant mesothelioma -2.100 4.9e-05
medulloblastoma, large-cell 3.100 4.9e-07
Multiple myeloma 1.394 3.8e-03
oligodendroglioma 1.500 3.0e-02
osteosarcoma 2.786 2.2e-07
ovarian cancer -1.900 1.4e-05
Pick disease 1.100 7.9e-03
primitive neuroectodermal tumor 1.900 4.8e-05
subependymal giant cell astrocytoma 1.491 2.2e-03

Gene RIF (8)

AA Sequence

MAAQCVTKVALNVSCANLLDKDIGSKSDPLCVLFLNTSGQQWYEVERTERIKNCLNPQFSKTFIIDYYFE      1 - 70
VVQKLKFGVYDIDNKTIELSDDDFLGECECTLGQIVSSKKLTRPLVMKTGRPAGKGSITISAEEIKDNRV     71 - 140
VLFEMEARKLDNKDLFGKSDPYLEFHKQTSDGNWLMVHRTEVVKNNLNPVWRPFKISLNSLCYGDMDKTI    141 - 210
KVECYDYDNDGSHDLIGTFQTTMTKLKEASRSSPVEFECINEKKRQKKKSYKNSGVISVKQCEITVECTF    211 - 280
LDYIMGGCQLNFTVGVDFTGSNGDPRSPDSLHYISPNGVNEYLTALWSVGLVIQDYDADKMFPAFGFGAQ    281 - 350
IPPQWQVSHEFPMNFNPSNPYCNGIQGIVEAYRSCLPQIKLYGPTNFSPIINHVARFAAAATQQQTASQY    351 - 420
FVLLIITDGVITDLDETRQAIVNASRLPMSIIIVGVGGADFSAMEFLDGDGGSLRSPLGEVAIRDIVQFV    421 - 490
PFRQFQNAPKEALAQCVLAEIPQQVVGYFNTYKLLPPKNPATKQQKQ                           491 - 537
//

Text Mined References (26)

PMID Year Title