Property Summary

NCBI Gene PubMed Count 18
PubMed Score 26.93
PubTator Score 15.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -1.400 7.1e-04
astrocytic glioma -1.600 1.9e-02
atypical teratoid / rhabdoid tumor -2.200 4.1e-04
Breast cancer -1.200 4.0e-04
cutaneous lupus erythematosus -2.000 2.6e-03
glioblastoma -1.300 6.4e-03
group 3 medulloblastoma -1.900 3.2e-02
invasive ductal carcinoma -1.422 1.0e-02
lung adenocarcinoma -1.100 3.4e-11
lung carcinoma 1.200 2.9e-17
medulloblastoma, large-cell -1.800 5.0e-04
nasopharyngeal carcinoma -1.200 6.8e-04
non-small cell lung cancer -2.301 1.4e-20
oligodendroglioma -1.300 4.2e-02
ovarian cancer -2.200 6.5e-07
periodontitis -1.100 4.4e-28
Pick disease -1.100 3.2e-03
posterior fossa group B ependymoma 1.100 1.7e-03
primitive neuroectodermal tumor -1.600 1.2e-02
psoriasis -1.700 5.2e-10
spina bifida -1.615 3.3e-02
subependymal giant cell astrocytoma -2.343 4.5e-03
ulcerative colitis -1.063 4.9e-02

 GO Function (1)

Gene RIF (8)

AA Sequence

MDAPRASAAKPPTGRKMKARAPPPPGKAATLHVHSDQKPPHDGALGSQQNLVRMKEALRASTMDVTVVLP      1 - 70
SGLEKRSVLNGSHAMMDLLVELCLQNHLNPSHHALEIRSSETQQPLSFKPNTLIGTLNVHTVFLKEKVPE     71 - 140
EKVKPGPPKVPEKSVRLVVNYLRTQKAVVRVSPEVPLQNILPVICAKCEVSPEHVVLLRDNIAGEELELS    141 - 210
KSLNELGIKELYAWDNRRETFRKSSLGNDETDKEKKKFLGFFKVNKRSNSKGCLTTPNSPSMHSRSLTLG    211 - 280
PSLSLGSISGVSVKSEMKKRRAPPPPGSGPPVQDKASEKVSLGSQIDLQKKKRRAPAPPPPQPPPPSPLI    281 - 350
PNRTEDKEENRKSTMVSLPLGSGSHCSPDGAPQVLSEAEETVSVGSCFASEDTTEDSGVMSSPSDIVSLD    351 - 420
SQQDSMKYKDKWATDQEDCSDQDLAGTPDLGPQKSPLWEKNGSENSHLRTEKAVTASNDEEDLLIAGEFR    421 - 490
KTLAELDEDLEEMEDSYETDTSSLTSSIHGASNHCPQDAMIPHGDTDAIPVTFIGEVSDDPVDSGLFSNR    491 - 560
NNNAGSFDSEGVASRRDSLAPLQAEHSQPHEKAREEVPALHPASHDVGKGIRVALSNISKDGNLMETAPR    561 - 630
VTSFASNLHTDNLNAKVKDKVYGCADGERTQATERVNSQPVNEKDSNDKNAALAPTSWHQRGQNPGKSYR    631 - 700
LKHGLTTYKIIPPKSEMRCYDRDVSLSTGAIKIDELGNLVSPHATGIRIISLSSSVPEAESQPIGKVREF    701 - 770
WRCNSVEKHLGRPSESSARGPPSTPVPTQTQNPESRLQADPKPISPQQKSAHHEGRNPLGEGRNQPPTMG    771 - 840
MGHVRVPAAHTTEVTFLKPQRRTSSQYVASAIAKRIGAPKVHADVVRPHGYAEKGYAGKAPVLAAPPVTV    841 - 910
KDDRTSSPHSETQGWKDGAQWPCVTPPNNHGEDLAVGAPPRGEVIGPHRKLSTQDRPAAIHRSSCFSLVQ    911 - 980
SSQRDRVSVGQSCGFSGKQSTSSQEASSASEPRRAPDGTDPPPPHTSDTQACSRELVNGSVRAPGHGEPS    981 - 1050
HPPGGSGTESHILLEREEKPSVFSTDGNETDSIWPPSIFGPKKKFKPVVQRPVPKDTSLHSALMEAIHSA   1051 - 1120
GGKDRLRKTAEHTGEGRPAKLSYTEAEGERSALLAAIRGHSGTCSLRKVASSASEELQSFRDAALSAQGS   1121 - 1190
ESPLLEDLGLLSPPAIPPPPPPPSQALSAPRTASRFSTGTLSNTADARQALMDAIRSGTGAARLRKVPLL   1191 - 1260
V//

Text Mined References (25)

PMID Year Title