Property Summary

NCBI Gene PubMed Count 16
Grant Count 9
R01 Count 4
Funding $1,338,665.25
PubMed Score 26.86
PubTator Score 15.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytic glioma -1.600 0.019
oligodendroglioma -1.300 0.042
psoriasis -1.700 0.000
cutaneous lupus erythematosus -2.000 0.003
glioblastoma -2.200 0.008
group 4 medulloblastoma -5.000 0.000
periodontitis -1.100 0.000
atypical teratoid / rhabdoid tumor -4.200 0.000
medulloblastoma, large-cell -1.800 0.001
primitive neuroectodermal tumor -2.800 0.001
ulcerative colitis -1.300 0.000
non-small cell lung cancer -2.301 0.000
lung adenocarcinoma -1.100 0.000
pediatric high grade glioma -1.900 0.003
posterior fossa group B ependymoma 1.100 0.002
subependymal giant cell astrocytoma -2.343 0.005
invasive ductal carcinoma -1.947 0.016
nasopharyngeal carcinoma -1.200 0.001
lung carcinoma 1.200 0.000
spina bifida -1.615 0.033
Pick disease -1.100 0.003
Breast cancer -1.200 0.000
ovarian cancer -2.200 0.000

 GO Function (1)

Gene RIF (6)

PMID Text
26334624 Ca2+/Calmodulin modulates Cobl's actin binding properties and furthermore promotes Cobl's previously identified interactions with the membrane-shaping F-BAR protein syndapin I, which accumulated with Cobl at nascent dendritic protrusion sites.
24415668 Filament severing displayed the greatest stringency and was abolished in all mutated forms of Cobl-KAB.
21816349 Cordon-Bleu works as a dynamizer of actin assembly by combining many properties of profilin with weak filament nucleating and powerful filament severing activities and sequestration of ADP-actin, which generate oscillatory polymerization kinetics.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDAPRASAAKPPTGRKMKARAPPPPGKAATLHVHSDQKPPHDGALGSQQNLVRMKEALRASTMDVTVVLP      1 - 70
SGLEKRSVLNGSHAMMDLLVELCLQNHLNPSHHALEIRSSETQQPLSFKPNTLIGTLNVHTVFLKEKVPE     71 - 140
EKVKPGPPKVPEKSVRLVVNYLRTQKAVVRVSPEVPLQNILPVICAKCEVSPEHVVLLRDNIAGEELELS    141 - 210
KSLNELGIKELYAWDNRRETFRKSSLGNDETDKEKKKFLGFFKVNKRSNSKGCLTTPNSPSMHSRSLTLG    211 - 280
PSLSLGSISGVSVKSEMKKRRAPPPPGSGPPVQDKASEKVSLGSQIDLQKKKRRAPAPPPPQPPPPSPLI    281 - 350
PNRTEDKEENRKSTMVSLPLGSGSHCSPDGAPQVLSEAEETVSVGSCFASEDTTEDSGVMSSPSDIVSLD    351 - 420
SQQDSMKYKDKWATDQEDCSDQDLAGTPDLGPQKSPLWEKNGSENSHLRTEKAVTASNDEEDLLIAGEFR    421 - 490
KTLAELDEDLEEMEDSYETDTSSLTSSIHGASNHCPQDAMIPHGDTDAIPVTFIGEVSDDPVDSGLFSNR    491 - 560
NNNAGSFDSEGVASRRDSLAPLQAEHSQPHEKAREEVPALHPASHDVGKGIRVALSNISKDGNLMETAPR    561 - 630
VTSFASNLHTDNLNAKVKDKVYGCADGERTQATERVNSQPVNEKDSNDKNAALAPTSWHQRGQNPGKSYR    631 - 700
LKHGLTTYKIIPPKSEMRCYDRDVSLSTGAIKIDELGNLVSPHATGIRIISLSSSVPEAESQPIGKVREF    701 - 770
WRCNSVEKHLGRPSESSARGPPSTPVPTQTQNPESRLQADPKPISPQQKSAHHEGRNPLGEGRNQPPTMG    771 - 840
MGHVRVPAAHTTEVTFLKPQRRTSSQYVASAIAKRIGAPKVHADVVRPHGYAEKGYAGKAPVLAAPPVTV    841 - 910
KDDRTSSPHSETQGWKDGAQWPCVTPPNNHGEDLAVGAPPRGEVIGPHRKLSTQDRPAAIHRSSCFSLVQ    911 - 980
SSQRDRVSVGQSCGFSGKQSTSSQEASSASEPRRAPDGTDPPPPHTSDTQACSRELVNGSVRAPGHGEPS    981 - 1050
HPPGGSGTESHILLEREEKPSVFSTDGNETDSIWPPSIFGPKKKFKPVVQRPVPKDTSLHSALMEAIHSA   1051 - 1120
GGKDRLRKTAEHTGEGRPAKLSYTEAEGERSALLAAIRGHSGTCSLRKVASSASEELQSFRDAALSAQGS   1121 - 1190
ESPLLEDLGLLSPPAIPPPPPPPSQALSAPRTASRFSTGTLSNTADARQALMDAIRSGTGAARLRKVPLL   1191 - 1260
V//

Text Mined References (23)

PMID Year Title
26334624 2015 The Actin Nucleator Cobl Is Controlled by Calcium and Calmodulin.
24415668 2014 Mutagenetic and electron microscopy analysis of actin filament severing by Cordon-Bleu, a WH2 domain protein.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23740775 2013 Association of granulomatosis with polyangiitis (Wegener's) with HLA-DPB1*04 and SEMA6A gene variants: evidence from genome-wide analysis.
23726511 2013 Genome-wide association study identifies new susceptibility loci for posttraumatic stress disorder.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21816349 2011 Cordon-Bleu uses WH2 domains as multifunctional dynamizers of actin filament assembly.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19430480 2009 Genome-wide association study and meta-analysis find that over 40 loci affect risk of type 1 diabetes.
More...