Property Summary

NCBI Gene PubMed Count 40
PubMed Score 20.84
PubTator Score 18.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.54628409757058E-26
Breast cancer 3099 6.36948417694087E-9
psoriasis 6685 1.30854795417149E-8
osteosarcoma 7933 9.38142456389362E-8
medulloblastoma, large-cell 6234 1.79000551301165E-6
ovarian cancer 8492 1.67450929738884E-5
pituitary cancer 1972 2.70652165741365E-5
malignant mesothelioma 3163 5.27923088259408E-5
glioblastoma 5572 3.42244059781882E-4
pediatric high grade glioma 2712 9.26169928597247E-4
atypical teratoid / rhabdoid tumor 4369 0.00104992171062016
Pick disease 1893 0.00134790985962895
Down syndrome 548 0.00297683499785197
astrocytic glioma 2241 0.00321705021321885
medulloblastoma 1524 0.00438487665417365
oligodendroglioma 2849 0.00444948879032922
colon cancer 1475 0.00580199826978076
ependymoma 2514 0.00681719534503935
hereditary spastic paraplegia 313 0.00735708051121662
lung cancer 4473 0.00837936268566587
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00932702607936099
subependymal giant cell astrocytoma 2287 0.0130486526136843
non primary Sjogren syndrome sicca 840 0.0156394843156075
adrenocortical adenoma 134 0.0239713948487907
Disease Target Count Z-score Confidence
Clostridium difficile colitis 12 3.168 1.6

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
astrocytic glioma 1.800 0.003
ependymoma 1.500 0.007
oligodendroglioma 1.700 0.004
psoriasis -1.400 0.000
glioblastoma -2.400 0.000
osteosarcoma 1.933 0.000
atypical teratoid / rhabdoid tumor -2.400 0.001
medulloblastoma -1.100 0.004
medulloblastoma, large-cell -2.200 0.000
hereditary spastic paraplegia -1.127 0.007
adrenocortical adenoma 1.216 0.024
intraductal papillary-mucinous neoplasm ... 1.300 0.009
lung cancer 1.100 0.008
colon cancer -1.200 0.006
pediatric high grade glioma -1.800 0.001
non primary Sjogren syndrome sicca -1.100 0.016
subependymal giant cell astrocytoma -1.984 0.013
lung carcinoma 1.300 0.000
Pick disease -1.200 0.001
Breast cancer -1.400 0.000
ovarian cancer -1.600 0.000
pituitary cancer 1.600 0.000
Down syndrome 1.100 0.003

Gene

PANTHER Protein Class (1)

PDB

3WOY  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid

 MGI Term (1)

Gene RIF (20)

PMID Text
25518939 PAR3 and aPKC control the organization of the Golgi through CLASP2 phosphorylation.
25231989 GSK3B-dependent phosphorylation and the level of CLASP2 play a role in the maintenance of acetylcholine receptor cluster size through the regulated capture and release of microtubule plus-ends.
24859005 Propose that CLASPs couple microtubule organization, vesicle transport and cell interactions with the ECM, establishing a local secretion pathway that facilitates focal adhesion turnover by severing cell-matrix connections.
24127197 Interstitial deletion of 3p22.3p22.2 encompassing ARPP21 and CLASP2 is a potential pathogenic factor for a syndromic form of intellectual disability.
23943871 Results suggest a previously unidentified role for the scaffolding protein 4.1R in locally controlling CLASP2 behavior, CLASP2 cortical platform turnover and GSK3 activity, enabling correct MT organization and dynamics essential for cell polarity.
23940118 The epiblast epithelial status was maintained by anchoring microtubules to the basal cortex via CLIP2, a microtubule plus-end tracking protein, and Dystroglycan, a transmembrane protein that bridges the cytoskeleton and basement membrane (BM).
23045552 propose that Cdk1 and Plk1 mediate a fine CLASP2 "phospho-switch" that temporally regulates kinetochore-microtubule attachment stability
23035100 Overexpression of human CLASP2 in mouse neurons caused the formation of multiple axons, enhanced dendritic branching, & Golgi condensation. These morphogenetic changes led to significant functional alterations in synaptic transmission.
22467876 Multisite phosphorylation disrupts arginine-glutamate salt bridge networks required for binding of cytoplasmic linker-associated protein 2 (CLASP2) to end-binding protein 1 (EB1).
22307330 Data show that CENP-E-mediated traction forces on misaligned chromosomes are responsible for the irreversible loss of spindle-pole integrity in CLASP1/2-depleted cells.
More...

AA Sequence

MAMGDDKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGAVDEDDF      1 - 70
IKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGA     71 - 140
LKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHV    141 - 210
PRLIPLITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMG    211 - 280
LRNHFPGEAETLYNSLEPSYQKSLQTYLKSSGSVASLPQSDRSSSSSQESLNRPFSSKWSTANPSTVAGR    281 - 350
VSAGSSKASSLPGSLQRSRSDIDVNAAAGAKAHHAAGQSVRRGRLGAGALNAGSYASLEDTSDKLDGTAS    351 - 420
EDGRVRAKLSAPLAGMGNAKADSRGRSRTKMVSQSQPGSRSGSPGRVLTTTALSTVSSGVQRVLVNSASA    421 - 490
QKRSKIPRSQGCSREASPSRLSVARSSRIPRPSVSQGCSREASRESSRDTSPVRSFQPLASRHHSRSTGA    491 - 560
LYAPEVYGASGPGYGISQSSRLSSSVSAMRVLNTGSDVEEAVADALKKPARRRYESYGMHSDDDANSDAS    561 - 630
SACSERSYSSRNGSIPTYMRQTEDVAEVLNRCASSNWSERKEGLLGLQNLLKNQRTLSRVELKRLCEIFT    631 - 700
RMFADPHGKRVFSMFLETLVDFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPN    701 - 770
DLQFNILMRFTVDQTQTPSLKVKVAILKYIETLAKQMDPGDFINSSETRLAVSRVITWTTEPKSSDVRKA    771 - 840
AQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHLRNTGNGTQSSMGSPLTRPTPRSPANWSSPLT    841 - 910
SPTNTSQNTLSPSAFDYDTENMNSEDIYSSLRGVTEAIQNFSFRSQEDMNEPLKRDSKKDDGDSMCGGPG    911 - 980
MSDPRAGGDATDSSQTALDNKASLLHSMPTHSSPRSRDYNPYNYSDSISPFNKSALKEAMFDDDADQFPD    981 - 1050
DLSLDHSDLVAELLKELSNHNERVEERKIALYELMKLTQEESFSVWDEHFKTILLLLLETLGDKEPTIRA   1051 - 1120
LALKVLREILRHQPARFKNYAELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTA   1121 - 1190
DYPINLAAIKMQTKVIERVSKETLNLLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLS   1191 - 1260
QLTGSKMKLLNLYIKRAQTGSGGADPTTDVSGQS                                       1261 - 1294
//

Text Mined References (52)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26003921 2015 CLASP2 Has Two Distinct TOG Domains That Contribute Differently to Microtubule Dynamics.
25518939 2015 PAR3 and aPKC regulate Golgi organization through CLASP2 phosphorylation to generate cell polarity.
25231989 2014 Acetylcholine receptor (AChR) clustering is regulated both by glycogen synthase kinase 3? (GSK3?)-dependent phosphorylation and the level of CLIP-associated protein 2 (CLASP2) mediating the capture of microtubule plus-ends.
24859005 2014 CLASPs link focal-adhesion-associated microtubule capture to localized exocytosis and adhesion site turnover.
24520051 2014 Abelson phosphorylation of CLASP2 modulates its association with microtubules and actin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24127197 2013 Interstitial deletion of 3p22.3p22.2 encompassing ARPP21 and CLASP2 is a potential pathogenic factor for a syndromic form of intellectual disability: a co-morbidity model with additional copy number variations in a large family.
23943871 2013 Protein 4.1R binds to CLASP2 and regulates dynamics, organization and attachment of microtubules to the cell cortex.
More...