Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.55
PubTator Score 3.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.100 4.7e-02
cutaneous lupus erythematosus 1.100 5.1e-04
intraductal papillary-mucinous neoplasm ... 1.100 2.1e-02
juvenile dermatomyositis 1.058 1.0e-11
lung adenocarcinoma -1.009 4.6e-06
osteosarcoma -1.218 3.7e-04
ovarian cancer -1.400 2.1e-05
psoriasis 1.500 7.1e-11
spina bifida -1.011 3.4e-02
tuberculosis -1.300 1.6e-07

Synonym

Accession O75113 A7MD49 Q2YDX1 N4BP1
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAARAVLDEFTAPAEKAELLEQSRGRIEGLFGVSLAVLGALGAEEPLPARIWLQLCGAQEAVHSAKEYIK      1 - 70
GICEPELEERECYPKDMHCIFVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKL     71 - 140
FENKENLPSSQKESEVKREFKQFVEAHADNYTMDLLILPTSLKKELLTLTQGEENLFETGDDEVIEMRDS    141 - 210
QQTEFTQNAATGLNISRDETVLQEEARNKAGTPVSELTKQMDTVLSSSPDVLFDPINGLTPDEEALSNER    211 - 280
ICQKRRFSDSEERHTKKQFSLENVQEGEILHDAKTLAGNVIADLSDSSADSENLSPDIKETTEEMEYNIL    281 - 350
VNFFKTMGYSQEIVEKVIKVYGPSTEPLLLLEEIEKENKRFQEDREFSAGTVYPETNKTKNKGVYSSTNE    351 - 420
LTTDSTPKKTQAHTQQNMVEKFSQLPFKVEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETD    421 - 490
GLSPSVASPSPKEVNFVSRGASSHQPRVPLFPENGLHQQPEPLLPNNMKSACEKRLGCCSSPHSKPNCST    491 - 560
LSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTLKIPYKLELKNEPGRTDLKHIVIDGSNVAIT    561 - 630
HGLKKFFSCRGIAIAVEYFWKLGNRNITVFVPQWRTRRDPNVTEQHFLTQLQELGILSLTPARMVFGERI    631 - 700
ASHDDRFLLHLADKTGGIIVTNDNFREFVNESVSWREIITKRLLQYTFVGDIFMVPDDPLGRSGPRLEEF    701 - 770
LQKEVCLRDMQPLLSALPNVGMFDPSFRVPGTQAASTSHQPPTRIQGAPSSHWLPQQPHFPLLPALPSLQ    771 - 840
QNLPMPAQRSSAETNELREALLKIFPDSEQRLKIDQILVAHPYMKDLNALSAMVLD                  841 - 896
//

Text Mined References (19)

PMID Year Title