Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $60,788.44
PubMed Score 2.75
PubTator Score 3.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.700 0.000
cutaneous lupus erythematosus 1.100 0.001
osteosarcoma -1.218 0.000
astrocytoma 1.100 0.047
juvenile dermatomyositis 1.058 0.000
tuberculosis and treatment for 3 months -1.400 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.017
lung adenocarcinoma -1.009 0.000
spina bifida -1.011 0.034
ovarian cancer -1.400 0.000

Synonym

Accession O75113 A7MD49 Q2YDX1 N4BP1
Symbols

Gene

PANTHER Protein Class (1)

 Grant Application (1)

Gene RIF (2)

PMID Text
24141722 The p34 interacts with the WW1 domain of NEDD4-1, an interaction that enhances NEDD4-1 stability.
19074885 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAARAVLDEFTAPAEKAELLEQSRGRIEGLFGVSLAVLGALGAEEPLPARIWLQLCGAQEAVHSAKEYIK      1 - 70
GICEPELEERECYPKDMHCIFVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKL     71 - 140
FENKENLPSSQKESEVKREFKQFVEAHADNYTMDLLILPTSLKKELLTLTQGEENLFETGDDEVIEMRDS    141 - 210
QQTEFTQNAATGLNISRDETVLQEEARNKAGTPVSELTKQMDTVLSSSPDVLFDPINGLTPDEEALSNER    211 - 280
ICQKRRFSDSEERHTKKQFSLENVQEGEILHDAKTLAGNVIADLSDSSADSENLSPDIKETTEEMEYNIL    281 - 350
VNFFKTMGYSQEIVEKVIKVYGPSTEPLLLLEEIEKENKRFQEDREFSAGTVYPETNKTKNKGVYSSTNE    351 - 420
LTTDSTPKKTQAHTQQNMVEKFSQLPFKVEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETD    421 - 490
GLSPSVASPSPKEVNFVSRGASSHQPRVPLFPENGLHQQPEPLLPNNMKSACEKRLGCCSSPHSKPNCST    491 - 560
LSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTLKIPYKLELKNEPGRTDLKHIVIDGSNVAIT    561 - 630
HGLKKFFSCRGIAIAVEYFWKLGNRNITVFVPQWRTRRDPNVTEQHFLTQLQELGILSLTPARMVFGERI    631 - 700
ASHDDRFLLHLADKTGGIIVTNDNFREFVNESVSWREIITKRLLQYTFVGDIFMVPDDPLGRSGPRLEEF    701 - 770
LQKEVCLRDMQPLLSALPNVGMFDPSFRVPGTQAASTSHQPPTRIQGAPSSHWLPQQPHFPLLPALPSLQ    771 - 840
QNLPMPAQRSSAETNELREALLKIFPDSEQRLKIDQILVAHPYMKDLNALSAMVLD                  841 - 896
//

Text Mined References (19)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24141722 2014 p34 is a novel regulator of the oncogenic behavior of NEDD4-1 and PTEN.
24133439 2013 Genome-wide association study of autistic-like traits in a general population study of young adults.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22491018 2013 Genome-wide association analysis implicates the involvement of eight loci with response to tocilizumab for the treatment of rheumatoid arthritis.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
More...