Property Summary

NCBI Gene PubMed Count 17
PubMed Score 41.09
PubTator Score 12.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.100 2.4e-04

Gene RIF (6)

AA Sequence

MSGGRAPAVLLGGVASLLLSFVWMPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSA      1 - 70
AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSV     71 - 140
HPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP                                   141 - 179
//

Text Mined References (21)

PMID Year Title