Property Summary

NCBI Gene PubMed Count 17
Grant Count 16
R01 Count 12
Funding $1,281,181.95
PubMed Score 39.24
PubTator Score 12.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.100 0.000

Gene RIF (6)

PMID Text
25557959 It mediates APP processing and Abeta generation.
25344844 Human CutA1 exhibits remarkably high thermodynamic stability at body temperature should be important for its protein catabolism in the human cells.
22351782 H component of CUTA as a novel BACE1-interacting protein that mediates the intracellular trafficking of BACE1 and the processing of APP to Abeta
19851445 Observational study of gene-disease association. (HuGE Navigator)
17924204 expression profile of CUTA gene in tissues was examined & revealed CUTA gene was constitutively expressed in the 18 tissues tested; CUTA isoform2 was mainly located in mitochondria as a new potential mitochondrial protein
10800960 Fluorescence in situ hybridization localizes the gene to chromosome 6p21.32-p21.2.

AA Sequence

MSGGRAPAVLLGGVASLLLSFVWMPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSA      1 - 70
AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSV     71 - 140
HPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP                                   141 - 179
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25557959 2015 Role of copper and the copper-related protein CUTA in mediating APP processing and A? generation.
25416956 2014 A proteome-scale map of the human interactome network.
25344844 2015 Thermodynamic analysis of unusually thermostable CutA1 protein from human brain and its protease susceptibility.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
22351782 2012 CutA divalent cation tolerance homolog (Escherichia coli) (CUTA) regulates ?-cleavage of ?-amyloid precursor protein (APP) through interacting with ?-site APP cleaving protein 1 (BACE1).
21269460 2011 Initial characterization of the human central proteome.
More...