Property Summary

NCBI Gene PubMed Count 22
PubMed Score 49.02
PubTator Score 45.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.100 3.6e-03
Astrocytoma, Pilocytic 1.100 6.6e-05
atypical teratoid/rhabdoid tumor 1.100 6.7e-03
breast carcinoma -1.500 3.9e-04
cystic fibrosis 1.344 3.7e-05
ductal carcinoma in situ -1.500 5.6e-04
ependymoma -1.200 2.1e-02
glioblastoma 1.200 9.6e-05
group 3 medulloblastoma 1.100 4.0e-02
intraductal papillary-mucinous adenoma (... 1.900 2.5e-04
intraductal papillary-mucinous carcinoma... 2.100 4.9e-04
intraductal papillary-mucinous neoplasm ... 1.600 8.5e-03
invasive ductal carcinoma -2.000 2.0e-03
lung adenocarcinoma -1.400 1.2e-09
lung cancer -2.100 3.7e-04
lung carcinoma -2.200 2.3e-23
malignant mesothelioma -3.000 4.5e-08
non-small cell lung cancer -1.126 1.7e-10
osteosarcoma -1.756 1.6e-03
ovarian cancer -1.500 2.9e-07
Rheumatoid arthritis 1.200 1.1e-03
subependymal giant cell astrocytoma 1.885 1.1e-02
tuberculosis 2.500 2.2e-09

Gene RIF (8)

AA Sequence

MEQPGAAASGAGGGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKE      1 - 70
KPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVV     71 - 140
QYISATAKSGGLKNSKHECTLSSQEYVHELRSGISDEKLLNCLESLRVSLTSNPVSWVNNFGHEGLGLLL    141 - 210
DELEKLLDKKQQENIDKKNQYKLIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQPNMMTEIVKILS    211 - 280
AICIVGEENILDKLLGAITTAAERNNRERFSPIVEGLENQEALQLQVACMQFINALVTSPYELDFRIHLR    281 - 350
NEFLRSGLKTMLPDLKEKENDELDIQLKVFDENKEDDLTELSHRLNDIRAEMDDMNEVYHLLYNMLKDTA    351 - 420
AENYFLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLHCSGMDPDFKYRQRLDIDLTHLIDSCVNKAKV    421 - 490
EESEQKAAEFSKKFDEEFTARQEAQAELQKRDEKIKELEAEIQQLRTQAQVLSSSSGIPGPPAAPPLPGV    491 - 560
GPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPYGMKQKK    561 - 630
MYKPEVSMKRINWSKIEPTELSENCFWLRVKEDKFENPDLFAKLALNFATQIKVQKNAEALEEKKTGPTK    631 - 700
KKVKELRILDPKTAQNLSIFLGSYRMPYEDIRNVILEVNEDMLSEALIQNLVKHLPEQKILNELAELKNE    701 - 770
YDDLCEPEQFGVVMSSVKMLQPRLSSILFKLTFEEHINNIKPSIIAVTLACEELKKSESFNRLLELVLLV    771 - 840
GNYMNSGSRNAQSLGFKINFLCKIRDTKSADQKTTLLHFIADICEEKYRDILKFPEELEHVESASKVSAQ    841 - 910
ILKSNLASMEQQIVHLERDIKKFPQAENQHDKFVEKMTSFTKTAREQYEKLSTMHNNMMKLYENLGEYFI    911 - 980
FDSKTVSIEEFFGDLNNFRTLFLEAVRENNKRREMEEKTRRAKLAKEKAEQEKLERQKKKKQLIDINKEG    981 - 1050
DETGVMDNLLEALQSGAAFRDRRKRIPRNPDNRRVPLERSRSRHNGAISSK                      1051 - 1101
//

Text Mined References (25)

PMID Year Title