Property Summary

NCBI Gene PubMed Count 18
PubMed Score 29.33
PubTator Score 15.27

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

AA Sequence

MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPL      1 - 70
IFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAF     71 - 140
ILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDC    141 - 210
LTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLS    211 - 280
KIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLK    281 - 350
GDYKTPANLKGYFQVNQNSTSSHLGSS                                               351 - 377
//

Text Mined References (19)

PMID Year Title