Property Summary

NCBI Gene PubMed Count 18
PubMed Score 30.13
PubTator Score 15.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis and treatment for 3 months 327 3.19105778914775E-6
ovarian cancer 8492 4.23788734963192E-6
ulcerative colitis 2087 3.74415840465598E-5
osteosarcoma 7933 5.03589653590382E-5
group 4 medulloblastoma 1875 7.54876603396679E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.6028878389952E-5
cystic fibrosis 1670 7.71642432077947E-5
medulloblastoma, large-cell 6234 1.6071954180695E-4
pituitary cancer 1972 1.7001077846072E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.68944533241567E-4
invasive ductal carcinoma 2950 3.21711152483777E-4
pancreatic cancer 2300 7.87538118575442E-4
primary Sjogren syndrome 789 0.00152698098166093
primary pancreatic ductal adenocarcinoma 1271 0.00202323473927611
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00220765082934981
atypical teratoid / rhabdoid tumor 4369 0.002594091005401
subependymal giant cell astrocytoma 2287 0.0104281459566518
primitive neuroectodermal tumor 3031 0.0133721045158198

Expression

Synonym

Accession O60704 B3KQA7 Q6FI98 Q9H0V4
Symbols TANGO13B

Gene

PANTHER Protein Class (1)

PDB

3AP1   3AP2   3AP3  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Pathway (1)

Gene RIF (13)

PMID Text
26108987 Using a quantum mechanics protocol of alanine scanning, the study identified unequivocally the role of the amino acids involved in the TPST-2 catalytic mechanism.
24569807 HIV-1 gp120 is sulfated at positions Y173 and Y177 in the V2 domain by tyrosyl sulfotransferase 2 (TPST2), leading to modulate gp120 epitope exposure and neutralization sensitivity
23481380 the first crystal structure of the human tyrosylprotein sulfotransferase isoform 2 complexed with a substrate peptide (C4P5Y3) derived from complement C4 and 3'-phosphoadenosine-5'-phosphate at 1.9 A resolution, is reported.
20460947 The p.R153H variant was found in a family with hereditary pancreatitis; however, it did not segregate with the disease.
20460947 Observational study of gene-disease association. (HuGE Navigator)
19402700 HIV-1 gp120 is sulfated at positions Y173 and Y177 in the V2 domain by tyrosyl sulfotransferase 2 (TPST2), leading to modulate gp120 epitope exposure and neutralization sensitivity
19343046 Observational study of gene-disease association. (HuGE Navigator)
18672380 The kinetic parameters of tyrosylprotein sulfotransferase-1 and -2, catalyzing tyrosine sulfation of CCR8 peptides, were determined using liquid chromatography electrospray ionisation mass spectrometry.
12169668 Tyrosine sulfation of CCR5 N-terminal peptide follows a discrete pattern and temporal sequence
12169668 HIV-1 gp120 is sulfated at positions Y173 and Y177 in the V2 domain by tyrosyl sulfotransferase 2 (TPST2), leading to modulate gp120 epitope exposure and neutralization sensitivity
More...

AA Sequence

MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPL      1 - 70
IFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAF     71 - 140
ILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDC    141 - 210
LTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLS    211 - 280
KIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLK    281 - 350
GDYKTPANLKGYFQVNQNSTSSHLGSS                                               351 - 377
//

Text Mined References (18)

PMID Year Title
26108987 2015 Computational Evidence for the Catalytic Mechanism of Tyrosylprotein Sulfotransferases: A Density Functional Theory Investigation.
23481380 2013 Crystal structure of human tyrosylprotein sulfotransferase-2 reveals the mechanism of protein tyrosine sulfation reaction.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20460947 2010 Sequence analysis of the human tyrosylprotein sulfotransferase-2 gene in subjects with chronic pancreatitis.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
18672380 2008 Mass spectrometric kinetic analysis of human tyrosylprotein sulfotransferase-1 and -2.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...