Property Summary

NCBI Gene PubMed Count 18
Grant Count 17
R01 Count 14
Funding $1,278,867.67
PubMed Score 30.13
PubTator Score 15.27

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
26108987 Using a quantum mechanics protocol of alanine scanning, the study identified unequivocally the role of the amino acids involved in the TPST-2 catalytic mechanism.
24569807 HIV-1 gp120 is sulfated at positions Y173 and Y177 in the V2 domain by tyrosyl sulfotransferase 2 (TPST2), leading to modulate gp120 epitope exposure and neutralization sensitivity
24569807 HIV-1 gp120 is sulfated at positions Y173 and Y177 in the V2 domain by tyrosyl sulfotransferase 2 (TPST2), leading to modulate gp120 epitope exposure and neutralization sensitivity
23481380 the first crystal structure of the human tyrosylprotein sulfotransferase isoform 2 complexed with a substrate peptide (C4P5Y3) derived from complement C4 and 3'-phosphoadenosine-5'-phosphate at 1.9 A resolution, is reported.
20460947 The p.R153H variant was found in a family with hereditary pancreatitis; however, it did not segregate with the disease.
20460947 Observational study of gene-disease association. (HuGE Navigator)
19402700 HIV-1 gp120 is sulfated at positions Y173 and Y177 in the V2 domain by tyrosyl sulfotransferase 2 (TPST2), leading to modulate gp120 epitope exposure and neutralization sensitivity
19402700 HIV-1 gp120 is sulfated at positions Y173 and Y177 in the V2 domain by tyrosyl sulfotransferase 2 (TPST2), leading to modulate gp120 epitope exposure and neutralization sensitivity
19343046 Observational study of gene-disease association. (HuGE Navigator)
18672380 The kinetic parameters of tyrosylprotein sulfotransferase-1 and -2, catalyzing tyrosine sulfation of CCR8 peptides, were determined using liquid chromatography electrospray ionisation mass spectrometry.
More...

AA Sequence

MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPL      1 - 70
IFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAF     71 - 140
ILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDC    141 - 210
LTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLS    211 - 280
KIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLK    281 - 350
GDYKTPANLKGYFQVNQNSTSSHLGSS                                               351 - 377
//

Text Mined References (18)

PMID Year Title
26108987 2015 Computational Evidence for the Catalytic Mechanism of Tyrosylprotein Sulfotransferases: A Density Functional Theory Investigation.
23481380 2013 Crystal structure of human tyrosylprotein sulfotransferase-2 reveals the mechanism of protein tyrosine sulfation reaction.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20460947 2010 Sequence analysis of the human tyrosylprotein sulfotransferase-2 gene in subjects with chronic pancreatitis.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
18672380 2008 Mass spectrometric kinetic analysis of human tyrosylprotein sulfotransferase-1 and -2.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...