Property Summary

NCBI Gene PubMed Count 34
Grant Count 5
R01 Count 5
Funding $330,812.66
PubMed Score 18.91
PubTator Score 27.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
posterior fossa group B ependymoma 1.300 0.000
glioblastoma 1.400 0.000
medulloblastoma, large-cell 1.200 0.000
non-small cell lung cancer 1.207 0.000
lung cancer 1.900 0.000
adult high grade glioma 1.400 0.002
atypical teratoid/rhabdoid tumor 1.100 0.001
nasopharyngeal carcinoma 1.100 0.001
lung carcinoma 1.400 0.000
ovarian cancer 1.400 0.004
pituitary cancer 1.200 0.000

Synonym

Accession O60678 B4DUC7
Symbols HRMT1L3

Gene

PANTHER Protein Class (2)

PDB

2FYT   3SMQ   4HSG   4QQN   4RYL  

Gene RIF (14)

PMID Text
25187371 PRMT3 translocation by palmitic acid is coupled to the binding of LXRalpha, which is responsible for the onset of fatty liver.
24320160 This work profilies substrates of protein arginine N-methyltransferase 3 with S-adenosyl-L-methionine analogues.
23912080 results show that protein arginine methyl transferase (PRMT)-3 and -5 methylate NaV1.5 in vitro, interact with NaV1.5 in human embryonic kidney (HEK) cells, and increase NaV1.5 current density
23635657 Mutational defects in PRMT3 is not the cause of frontotemporal lobar degeneration.
22795084 The crystal structure of PRMT3 in complex with an inhibitor as well as kinetic analysis reveals an allosteric site of inhibition.
21942715 release of VHL30 from the E3 ligase complex, promotes the binding of VHL30 to a protein arginine methyltransferase, PRMT3
21059412 The Tyr87Cys and Tyr87Glu-PRMT3 variants had markedly decreased affinity to ribosomal protein S2 and, consequently, reduced enzymatic activity compared to the wild-type enzyme.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19641605 results suggest that the pathological mutation in the PABPN1 gene alters the protein conformation and induces a preferential interaction with type I PRMTs and Hsp70 chaperones
More...

AA Sequence

MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSAEETFSHCKSE      1 - 70
HQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYE     71 - 140
PVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIA    141 - 210
DLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKK    211 - 280
VLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNK    281 - 350
YLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIK    351 - 420
HIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKP    421 - 490
FSVKAGEALKGKVTVHKSKKDPRSLTVTLTLNNSTQTYGLQ                                 491 - 531
//

Text Mined References (44)

PMID Year Title
25187371 2015 PRMT3 regulates hepatic lipogenesis through direct interaction with LXR?.
24320160 2014 Profiling substrates of protein arginine N-methyltransferase 3 with S-adenosyl-L-methionine analogues.
23912080 2013 Protein arginine methyl transferases-3 and -5 increase cell surface expression of cardiac sodium channel.
23635657 2013 Mutations in protein N-arginine methyltransferases are not the cause of FTLD-FUS.
23445220 2013 Exploiting an allosteric binding site of PRMT3 yields potent and selective inhibitors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22795084 2012 An allosteric inhibitor of protein arginine methyltransferase 3.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21942715 2011 Proteomic dissection of the von Hippel-Lindau (VHL) interactome.
More...