Property Summary

Ligand Count 8
NCBI Gene PubMed Count 36
PubMed Score 21.23
PubTator Score 27.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.400 1.8e-03
atypical teratoid/rhabdoid tumor 1.100 5.1e-04
ependymoma 1.100 2.4e-06
glioblastoma 1.400 6.6e-07
lung cancer 1.400 3.7e-04
lung carcinoma 1.400 1.1e-21
malignant mesothelioma 1.300 8.5e-06
medulloblastoma, large-cell 1.200 3.2e-04
nasopharyngeal carcinoma 1.100 5.4e-04
non-small cell lung cancer 1.207 9.6e-16
ovarian cancer 1.400 4.0e-03
pituitary cancer 1.200 4.5e-04

Gene RIF (15)

AA Sequence

MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSAEETFSHCKSE      1 - 70
HQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYE     71 - 140
PVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIA    141 - 210
DLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKK    211 - 280
VLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNK    281 - 350
YLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIK    351 - 420
HIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKP    421 - 490
FSVKAGEALKGKVTVHKSKKDPRSLTVTLTLNNSTQTYGLQ                                 491 - 531
//

Text Mined References (46)

PMID Year Title