Property Summary

NCBI Gene PubMed Count 23
PubMed Score 52.62
PubTator Score 50.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.134 4.9e-03
adult high grade glioma 1.400 2.8e-03
atypical teratoid / rhabdoid tumor 1.200 9.7e-06
cutaneous lupus erythematosus 2.800 6.7e-03
ductal carcinoma in situ 2.000 6.8e-03
ependymoma 1.100 3.5e-05
glioblastoma 1.700 2.5e-06
interstitial cystitis 2.400 5.7e-03
invasive ductal carcinoma 1.900 2.3e-02
lung cancer -1.200 1.9e-03
medulloblastoma 1.200 1.6e-04
medulloblastoma, large-cell 1.700 3.3e-05
nasopharyngeal carcinoma -1.500 4.7e-03
osteosarcoma -3.020 5.6e-05
ovarian cancer -1.500 6.3e-13
primary Sjogren syndrome 2.100 5.5e-04
psoriasis 1.900 3.2e-89
ulcerative colitis 1.500 1.6e-02
Waldenstrons macroglobulinemia 1.223 2.1e-02

Gene RIF (15)

AA Sequence

MDFWLWPLYFLPVSGALRILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGTVVSTTNFIKA      1 - 70
EYKGRVTLKQYPRKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTQKVTLNVHSEYEPSWEEQPMPETPK     71 - 140
WFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTA    141 - 210
SKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGREGQGFHILIPTILGLFLLALLGLVVKRAVERRK    211 - 280
ALSRRARRLAVRMRALESSQRPRGSPRPRSQNNIYSACPRRARGADAAGTGEAPVPGPGAPLPPAPLQVS    281 - 350
ESPWLHAPSLKTSCEYVSLYHQPAAMMEDSDSDDYINVPA                                  351 - 390
//

Text Mined References (26)

PMID Year Title