Property Summary

NCBI Gene PubMed Count 23
Grant Count 17
R01 Count 2
Funding $2,078,108.19
PubMed Score 50.68
PubTator Score 50.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (15)

PMID Text
22675200 Toso/FcmuR is an IgM receptor capable of activating signaling molecules and whose expression alone is not inherently antiapoptotic.
21908732 TOSO/FAIM3 may play a role in immune surveillance and contribute to B cell activation
21908424 Enhanced levels of both membrane-bound and soluble forms of FcmuR in CLL patients.
21756805 Overexpression of TOSO in chronic lymphocytic leukemia is associated with disease progression.
21613257 we demonstrate that the immune specific cell surface molecule Toso exhibits antiapoptotic effects on death receptor signaling by a novel regulatory mechanism involving the adaptor kinase RIP1
21264533 Overexpression of TOSO gene is associated with chronic lymphocytic leukemia.
21133733 TOSO is overexpressed and correlated with disease progression in chronic lymphocytic leukemia.
20410497 This review focuses on possible functional consequences of Plasmodium falciparum EMP1 protein interaction with the IgM receptor, including interference with immunologic signaling and clearance mechanisms and blocking of specific antibody binding.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20042454 These results identify TOSO/FAIM3 as a receptor for IgM
More...

AA Sequence

MDFWLWPLYFLPVSGALRILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGTVVSTTNFIKA      1 - 70
EYKGRVTLKQYPRKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTQKVTLNVHSEYEPSWEEQPMPETPK     71 - 140
WFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTA    141 - 210
SKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGREGQGFHILIPTILGLFLLALLGLVVKRAVERRK    211 - 280
ALSRRARRLAVRMRALESSQRPRGSPRPRSQNNIYSACPRRARGADAAGTGEAPVPGPGAPLPPAPLQVS    281 - 350
ESPWLHAPSLKTSCEYVSLYHQPAAMMEDSDSDDYINVPA                                  351 - 390
//

Text Mined References (26)

PMID Year Title
25888699 2015 Nomenclature of Toso, Fas apoptosis inhibitory molecule 3, and IgM FcR.
22675200 2012 Toso, a functional IgM receptor, is regulated by IL-2 in T and NK cells.
21908732 2011 TOSO, the Fcmicro receptor, is highly expressed on chronic lymphocytic leukemia B cells, internalizes upon IgM binding, shuttles to the lysosome, and is downregulated in response to TLR activation.
21908424 2011 Enhanced levels of both the membrane-bound and soluble forms of IgM Fc receptor (Fc?R) in patients with chronic lymphocytic leukemia.
21756805 2011 [Expression and prognostic significance of TOSO in CD19+ B cells from Chinese CLL patients].
21613257 2011 Toso regulates the balance between apoptotic and nonapoptotic death receptor signaling by facilitating RIP1 ubiquitination.
21264533 2012 Overexpression of Fc mu receptor (FCMR, TOSO) gene in chronic lymphocytic leukemia patients.
21133733 2011 TOSO is overexpressed and correlated with disease progression in Chinese patients with chronic lymphocytic leukemia.
20410497 2010 IgM, Fc mu Rs, and malarial immune evasion.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
More...