Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.09
PubTator Score 2.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Barrett's esophagus 1.400 4.0e-02
ductal carcinoma in situ -1.200 9.0e-03
ependymoma 1.100 5.4e-08
esophageal adenocarcinoma 1.500 1.8e-02
intraductal papillary-mucinous carcinoma... 1.100 2.4e-02
intraductal papillary-mucinous neoplasm ... 1.600 5.0e-03
invasive ductal carcinoma -1.300 3.6e-02
lung adenocarcinoma 1.245 8.4e-05
lung cancer -1.200 3.1e-04
Multiple myeloma 1.250 8.7e-04
non primary Sjogren syndrome sicca 1.200 2.4e-02
oligodendroglioma 1.500 4.7e-02
osteosarcoma -1.498 3.0e-04
ovarian cancer -1.500 3.0e-04
pancreatic cancer 1.300 2.0e-02

Gene RIF (3)

AA Sequence

MGQCGITSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYTLIPAVVIIAVGALLFIIGLI      1 - 70
GCCATIRESRCGLATFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKTYNGTNPDAASRAIDY     71 - 140
VQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQEIMM    141 - 210
HVIWAALAFAAIQLLGMLCACIVLCRRSRDPAYELLITGGTYA                               211 - 253
//

Text Mined References (15)

PMID Year Title