Property Summary

NCBI Gene PubMed Count 185
Grant Count 441
R01 Count 257
Funding $71,286,686.43
PubMed Score 580.95
PubTator Score 285.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession O60602 B1AZ05 B3Y633 B9VJ63 D1CS80 D3DTB8 O15456 Q32MI2 Q32MI3
Symbols SLE1
TIL3
SLEB1
MELIOS

Gene

PANTHER Protein Class (1)

PDB

1P95   3J0A  

Gene RIF (166)

PMID Text
26695672 TLR2 and 5 polymorphisms (rs5743708, rs3804099 and rs5744105) may not serve as the susceptible gene for sepsis in newborn infants.
26645913 These results indicate that in response to Pseudomonas aeruginosa or flagellin, EGFR associates with and tyrosine phosphorylates MUC1-CT in primary normal human bronchial epithelial cells, leading to increased MUC1-CT association with TLR5
26615831 Study elucidated the relationship between TLR5 and caveolin-1 at the transcriptional and translational levels using human cells, results suggest that caveolin-1 is a crucial regulator for maintaining and controlling TLR5 expression.
26548862 Study showed that MyD88 Toll/interleukin-1 receptor (TIR) domain interacted with TLR5TIR but not with TLR6TIR. The solubility of both TLR5TIR and TLR6TIR were influenced by its binding partner MyD88TIR. Moreover, TLR5TIR exhibited increased solubility.
26220208 p53-dependent amplification of transcriptional response to TLR5 activation required expression of NFkappaB subunit p65 and was mediated by several molecular mechanisms
25995217 genetic polymorphism is not associated with duodenal ulcer
25862837 TLR 2, 4, 5, 7 and 9 appear to reflect certain clinicopathological variables and prognostic markers of MCC tumors
25789623 TLR5 variants R392X and N592S showed significant association with UC patients but TLR 1, 2, 3, 6 variants did not show any association.
25789623 Association of TLR5 Gene Polymorphisms in Ulcerative Colitis Patients of North India and Their Role in Cytokine Homeostasis.
25611816 Establishing bacterial flagellin-recognizing toll-like receptor 5 (TLR5) as a novel link between gut microbiota composition, adipose tissue inflammation, and obesity.
More...

AA Sequence

MGDHLDLLLGVVLMAGPVFGIPSCSFDGRIAFYRFCNLTQVPQVLNTTERLLLSFNYIRTVTASSFPFLE      1 - 70
QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFHLFELRLYFCGLSDAVLKDGY     71 - 140
FRNLKALTRLDLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQIFLVCEHELEPLQGKTLSFFSLAANSLYS    141 - 210
RVSVDWGKCMNPFRNMVLEILDVSGNGWTVDITGNFSNAISKSQAFSLILAHHIMGAGFGFHNIKDPDQN    211 - 280
TFAGLARSSVRHLDLSHGFVFSLNSRVFETLKDLKVLNLAYNKINKIADEAFYGLDNLQVLNLSYNLLGE    281 - 350
LYSSNFYGLPKVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPK    351 - 420
INLTANLIHLSENRLENLDILYFLLRVPHLQILILNQNRFSSCSGDQTPSENPSLEQLFLGENMLQLAWE    421 - 490
TELCWDVFEGLSHLQVLYLNHNYLNSLPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQL    491 - 560
LAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCD    561 - 630
EEEVLKSLKFSLFIVCTVTLTLFLMTILTVTKFRGFCFICYKTAQRLVFKDHPQGTEPDMYKYDAYLCFS    631 - 700
SKDFTWVQNALLKHLDTQYSDQNRFNLCFEERDFVPGENRIANIQDAIWNSRKIVCLVSRHFLRDGWCLE    701 - 770
AFSYAQGRCLSDLNSALIMVVVGSLSQYQLMKHQSIRGFVQKQQYLRWPEDFQDVGWFLHKLSQQILKKE    771 - 840
KEKKKDNNIPLQTVATIS                                                        841 - 858
//

Text Mined References (188)

PMID Year Title
26695672 2015 [Association between toll-like receptors 2 and 5 polymorphisms and neonatal sepsis].
26645913 2016 Pseudomonas aeruginosa stimulates tyrosine phosphorylation of and TLR5 association with the MUC1 cytoplasmic tail through EGFR activation.
26615831 2015 Direct Regulation of TLR5 Expression by Caveolin-1.
26548862 2016 In Vitro Reconstitution of the Toll/Interleukin-1 Receptor (TIR) Domain Complex Between TLR5/6 and Myd88.
26220208 2015 p53 amplifies Toll-like receptor 5 response in human primary and cancer cells through interaction with multiple signal transduction pathways.
25995217 2015 Polymorphisms in TLR9 but not in TLR5 increase the risk for duodenal ulcer and alter cytokine expression in the gastric mucosa.
25862837 2015 The expression of Toll-like receptors 2, 4, 5, 7 and 9 in Merkel cell carcinoma.
25789623 2015 Association of TLR5 gene polymorphisms in ulcerative colitis patients of north India and their role in cytokine homeostasis.
25611816 2015 Toll-like receptor 5 in obesity: the role of gut microbiota and adipose tissue inflammation.
25603867 2015 [Expression of TLR5 in different types of non-small cell lung cancer cell lines and its activation mechanism].
More...