Property Summary

NCBI Gene PubMed Count 26
Grant Count 9
R01 Count 7
Funding $8,729,079.85
PubMed Score 59.54
PubTator Score 37.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.100 0.005
oligodendroglioma -1.100 0.002
psoriasis -1.700 0.000
Atopic dermatitis -1.500 0.039
breast carcinoma -2.200 0.013
fibroadenoma -3.800 0.014
ductal carcinoma in situ -4.100 0.000
invasive ductal carcinoma -4.700 0.001

Gene RIF (23)

PMID Text
26118629 These data establish a functional role for Cidea and suggest that, in humans, the association between Cidea levels in white fat and metabolic health is not only correlative but also causative.
25720106 The lowest mean relative of the gene expression for CIDE-A was observed in the group of obese patients with aortic aneurysm and lipid disorders
24413203 Since Cide-A protein plays a role in the development of metabolic diseases such as obesity, metabolic syndrome, type 2 diabetes and their vascular complications, CIDE -A gene and protein are potential therapeutic targets for these diseases.
24057179 the association of tag-single nucleotide polymorphisms and haplotype structures of the CIDEA gene with obesity in a Han Chinese population, was investigated.
23475172 CIDE proteins expression correlate with tumor and survival characteristics in patients with renal cell carcinoma.
21636835 Insulin regulates CIDEA and CIDEC expression via PI3K, and it regulates expression of each protein via Akt1/2-and JNK2-dependent pathways, respectively, in human adipocytes.
21315073 CIDEA binds to liver X receptors and regulates their activity in vitro.
21106268 The proportion of subjects with CIDEA) gene V115F (G/T) polymorphism with phenotypes of metabolic syndrome in a Chinese population was significantly higher based on genotype, in the order: GG
20945533 CIDEC is essential for the differentiation of adipose tissue
20810722 These data indicate that the carboxy-terminal domain of Cidea directs lipid droplet targeting, lipid droplet clustering, and triglyceride accumulation, whereas the amino terminal domain is required for Cidea-mediated development of enlarged lipid droplets
More...

AA Sequence

MEAARDYAGALIRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIAT      1 - 70
GLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKD     71 - 140
FIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRS    141 - 210
QAKGRFTCG                                                                 211 - 219
//

Text Mined References (27)

PMID Year Title
26118629 2015 Cidea improves the metabolic profile through expansion of adipose tissue.
25720106 2015 CIDE-A gene expression in patients with obesity qualified for endovascular treatment of abdominal aorta aneurysm.
24413203 2013 CIDE--A gene expression in patients with abdominal obesity and LDL hyperlipoproteinemia qualified for surgical revascularization in chronic limb ischemia.
24057179 2013 The genetic contribution of CIDEA polymorphisms, haplotypes and loci interaction to obesity in a Han Chinese population.
23475172 2013 Expression of CIDE proteins in clear cell renal cell carcinoma and their prognostic significance.
21636835 2011 Differential regulation of CIDEA and CIDEC expression by insulin via Akt1/2- and JNK2-dependent pathways in human adipocytes.
21315073 2011 CIDEA interacts with liver X receptors in white fat cells.
21106268 2011 Association of the cell death-inducing DNA fragmentation factor alpha-like effector A (CIDEA) gene V115F (G/T) polymorphism with phenotypes of metabolic syndrome in a Chinese population.
20945533 2010 Cell death-inducing DFF45-like effector, a lipid droplet-associated protein, might be involved in the differentiation of human adipocytes.
20810722 2010 Identification of the lipid droplet targeting domain of the Cidea protein.
More...