Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.45
PubTator Score 3.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia -1.500 4.4e-03
adrenocortical carcinoma -1.370 2.6e-04
Breast cancer -1.100 4.1e-06
invasive ductal carcinoma -1.100 1.4e-02
lung cancer -1.400 8.1e-04
medulloblastoma, large-cell -1.200 4.4e-03
mucosa-associated lymphoid tissue lympho... 1.050 4.4e-02
Multiple myeloma 1.110 3.1e-03
non-small cell lung cancer -1.140 1.2e-12
ovarian cancer -2.600 3.8e-11
psoriasis -1.300 8.7e-09
tuberculosis and treatment for 6 months -1.100 2.3e-02
ulcerative colitis -1.072 1.0e-02

Gene RIF (1)

AA Sequence

MDDSKVVGGKVKKPGKRGRKPAKIDLKAKLERSRQSARECRARKKLRYQYLEELVSSRERAICALREELE      1 - 70
MYKQWCMAMDQGKIPSEIKALLTGEEQNKSQQNSSRHTKAGKTDANSNSW                         71 - 120
//

Text Mined References (12)

PMID Year Title