Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.45
PubTator Score 3.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.295 0.001
psoriasis -1.300 0.000
medulloblastoma, large-cell -1.200 0.004
ulcerative colitis -1.072 0.010
adrenocortical carcinoma -1.641 0.000
tuberculosis and treatment for 6 months -1.300 0.025
non-small cell lung cancer -1.140 0.000
lung cancer -2.000 0.000
Breast cancer -1.100 0.000
mucosa-associated lymphoid tissue lympho... 1.050 0.044
invasive ductal carcinoma -1.100 0.014
acute myeloid leukemia -1.500 0.004
ovarian cancer -3.100 0.000

Gene RIF (1)

PMID Text
23077088 Data indicate that LRP6, BCL2L14, DUSP16, CREBL2, and CDKN1B were involed in centromeric (12p11.21-12p13.2) deletion in ETV6-RUNX1 B-cell precursor acute lymphoblastic leukemia (BCP-ALL).

AA Sequence

MDDSKVVGGKVKKPGKRGRKPAKIDLKAKLERSRQSARECRARKKLRYQYLEELVSSRERAICALREELE      1 - 70
MYKQWCMAMDQGKIPSEIKALLTGEEQNKSQQNSSRHTKAGKTDANSNSW                         71 - 120
//

Text Mined References (12)

PMID Year Title
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23077088 2013 Abnormalities of the der(12)t(12;21) in ETV6-RUNX1 acute lymphoblastic leukemia.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18063805 2008 AMP-activated protein kinase phosphorylates transcription factors of the CREB family.
16541075 2006 The finished DNA sequence of human chromosome 12.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9693048 1998 CREBL2, a novel transcript from the chromosome 12 region flanked by ETV6 and CDKN1B.
More...