Property Summary

NCBI Gene PubMed Count 53
PubMed Score 45.29
PubTator Score 34.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
acute quadriplegic myopathy 1.646 5.9e-06
Amyotrophic lateral sclerosis 1.079 2.6e-06
astrocytoma 1.100 1.1e-28
atypical teratoid / rhabdoid tumor 1.500 3.0e-09
Breast cancer -1.400 5.1e-15
dermatomyositis 1.500 1.4e-03
Down syndrome 1.100 1.0e-02
glioblastoma 1.100 1.5e-07
group 3 medulloblastoma 1.400 9.5e-03
hepatocellular carcinoma 1.100 8.8e-04
intraductal papillary-mucinous neoplasm ... -1.400 1.5e-02
invasive ductal carcinoma -1.100 3.3e-03
lung adenocarcinoma 1.122 2.2e-05
lung cancer 1.100 3.7e-04
medulloblastoma, large-cell 1.900 4.9e-05
Multiple myeloma 1.298 6.3e-03
non primary Sjogren syndrome sicca 1.100 1.8e-02
non-small cell lung cancer 1.214 1.6e-19
oligodendroglioma 1.100 1.8e-15
osteosarcoma 1.249 3.8e-04
ovarian cancer -1.200 1.5e-03
pediatric high grade glioma 1.200 4.9e-05
primitive neuroectodermal tumor 1.400 1.6e-04
psoriasis 1.200 7.9e-08
tuberculosis and treatment for 6 months 1.100 9.8e-06
Waldenstrons macroglobulinemia 1.513 7.6e-03

Gene RIF (19)

AA Sequence

MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDERAIEALKEFNE      1 - 70
DGALAVLQQFKDSDLSHVQNKSAFLCGVMKTYRQREKQGTKVADSSKGPDEAKIKALLERTGYTLDVTTG     71 - 140
QRKYGGPPPDSVYSGQQPSVGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTF    141 - 210
CTKEAAQEAVKLYNNHEIRSGKHIGVCISVANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPD    211 - 280
DKKKNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMAKVKVLFVRNLANTVT    281 - 350
EEILEKAFSQFGKLERVKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQR    351 - 420
QAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYED    421 - 490
FQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARGGAQQQRGRGVRGARGGRGGN    491 - 560
VGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENQEFYQDTFGQQWK           561 - 623
//

Text Mined References (63)

PMID Year Title