Property Summary

NCBI Gene PubMed Count 48
Grant Count 5
R01 Count 3
Funding $257,365.07
PubMed Score 41.36
PubTator Score 34.80

Knowledge Summary

Patent

No data available

Expression

Gene RIF (21)

PMID Text
25100733 hnRNPQ6 is required for APOBEC1-enhanced IL8 production.
23980891 The inhibitory effect of hnRNP Q on YB-1 mRNA translation can be explained by its ability to pro-mote YB-1 binding to the regulatory element within the YB-1 mRNA 3' UTR.
23946508 The hnRNP Q is a novel substrate of SHP2 and the SHP2 activity may be also involved in RNA metabolisms via dephosphorylation of hnRNP Q.
23679954 These data indicate that hnRNP Q can stimulate the protein production of HIV-1 Rev-dependent mRNAs without changing mRNA levels and mRNA export, respectively.
23679954 hnRNP Q overexpression in HIV-1 infected HeLa cells increases levels of the HIV-1 Gag-p24 protein, while levels of viral Rev-dependent mRNAs are not affected
23679954 hnRNP Q overexpression in HIV-1 infected HeLa cells increases levels of the HIV-1 Gag-p24 protein, while levels of viral Rev-dependent mRNAs are not affected
23679954 hnRNP Q overexpression in HIV-1 infected HeLa cells increases levels of the HIV-1 Gag-p24 protein, while levels of viral Rev-dependent mRNAs are not affected
23125841 hnRNP Q overexpression in HIV-1 infected HeLa cells increases levels of the HIV-1 Gag-p24 protein, while levels of viral Rev-dependent mRNAs are not affected
23125841 hnRNP Q overexpression in HIV-1 infected HeLa cells increases levels of the HIV-1 Gag-p24 protein, while levels of viral Rev-dependent mRNAs are not affected
23125841 hnRNP Q overexpression in HIV-1 infected HeLa cells increases levels of the HIV-1 Gag-p24 protein, while levels of viral Rev-dependent mRNAs are not affected
More...

AA Sequence

MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDERAIEALKEFNE      1 - 70
DGALAVLQQFKDSDLSHVQNKSAFLCGVMKTYRQREKQGTKVADSSKGPDEAKIKALLERTGYTLDVTTG     71 - 140
QRKYGGPPPDSVYSGQQPSVGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTF    141 - 210
CTKEAAQEAVKLYNNHEIRSGKHIGVCISVANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPD    211 - 280
DKKKNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMAKVKVLFVRNLANTVT    281 - 350
EEILEKAFSQFGKLERVKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQR    351 - 420
QAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYED    421 - 490
FQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARGGAQQQRGRGVRGARGGRGGN    491 - 560
VGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENQEFYQDTFGQQWK           561 - 623
//

Text Mined References (57)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25100733 2014 The RNA-editing enzyme APOBEC1 requires heterogeneous nuclear ribonucleoprotein Q isoform 6 for efficient interaction with interleukin-8 mRNA.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23980891 2013 Identification of proteins specifically interacting with YB-1 mRNA 3' UTR and the effect of hnRNP Q on YB-1 mRNA translation.
23946508 2013 Heterogeneous nuclear ribonucleoprotein Q is a novel substrate of SH2 domain-containing phosphatase-2.
23679954 2013 Heterogenous nuclear ribonucleoprotein Q increases protein expression from HIV-1 Rev-dependent transcripts.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23071094 2012 Heterotrimeric GAIT complex drives transcript-selective translation inhibition in murine macrophages.
More...