Property Summary

NCBI Gene PubMed Count 43
Grant Count 38
R01 Count 23
Funding $3,377,753.44
PubMed Score 31.18
PubTator Score 24.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 0.005
osteosarcoma -1.365 0.002
non-small cell lung cancer -1.640 0.000
interstitial cystitis 1.100 0.004
lung adenocarcinoma -1.100 0.000
lung carcinoma -1.300 0.000
spina bifida 1.175 0.041
mucosa-associated lymphoid tissue lympho... 1.691 0.013

Gene RIF (22)

PMID Text
27265473 DOK2 and DOK3 expression was significantly reduced in HTLV-1-infected T cells.
25252871 point mutations in DOK1 and DOK2 genes are detected with low frequency in chronic myelomonocytic leukemia but may have consequences for the function of the DOK2 PTB domain
24963146 Taken together, these results reveal that Dok1 and Dok2 proteins are involved in an intrinsic negative feedback loop downstream of natural killer-cell-activating receptors in mouse and human.
24255704 DOK2 as a tumor suppressor in EGFR-mutant lung adenocarcinoma
22130622 DOK2 is a marker of poor prognosis in patients with gastric cancer after curative resection
21749457 data indicate that DOK2 is altered in gastric (GC) and colorectal cancers (CRC) by loss of expressions; data indicate that somatic mutation of DOK2 may be rare in GC, CRC, breast cancer, prostate cancer and liver cancer
21329978 Data indicate there was no evidence of DOK2 somatic mutation in the leukemias analyzed.
21078907 Dok1 negatively regulates Dok2-mediated CD200R signaling through the recruitment of CrkL.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20139980 Identification of DOK genes as lung tumor suppressors.
More...

AA Sequence

MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVIRLSDCLRVAE      1 - 70
AGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFPGQRKELSGPEGKQSRPCMEENELYS     71 - 140
SAVTVGPHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFS    141 - 210
FEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNAAPATPQPQPATIPASLPRPDSPYSRPHDSLPP    211 - 280
PSPTTPVPAPRPRGQEGEYAVPFDAVARSLGKNFRGILAVPPQLLADPLYDSIEETLPPRPDHIYDEPEG    281 - 350
VAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK            351 - 412
//

Text Mined References (45)

PMID Year Title
27265473 2016 Expression of DOK1, 2, and 3 genes in HTLV-1-infected T cells.
25252871 2015 Mutational analysis of the DOK2 haploinsufficient tumor suppressor gene in chronic myelomonocytic leukemia (CMML).
24974787 2015 A genome-wide association study suggests an association of Chr8p21.3 (GFRA2) with diabetic neuropathic pain.
24963146 2014 Dok1 and Dok2 proteins regulate natural killer cell development and function.
24255704 2013 DOK2 inhibits EGFR-mutated lung adenocarcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22130622 2012 DOK2 as a marker of poor prognosis of patients with gastric adenocarcinoma after curative resection.
21749457 2011 Mutational and expressional analysis of a haploinsufficient tumor suppressor gene DOK2 in gastric and colorectal cancers.
21329978 2011 Mutational analysis of DOK2 tumor suppressor gene in acute leukemias.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
More...