Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.24
PubTator Score 23.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 7.22102634525324E-23
psoriasis 6685 1.73241450446472E-12
Breast cancer 3099 3.49505654416067E-8
pituitary cancer 1972 3.50196275034704E-6
ovarian cancer 8492 3.52336296313569E-6
pancreatic cancer 2300 6.96341398594874E-6
osteosarcoma 7933 8.74889605445912E-5
interstitial cystitis 2299 1.74949187497385E-4
Atopic dermatitis 944 7.17673558436208E-4
hepatocellular carcinoma 550 7.18947079382202E-4
cutaneous lupus erythematosus 1056 0.00239382595615737
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00390455132788168
lung adenocarcinoma 2714 0.00440740304670584
Rheumatoid Arthritis 1171 0.0073049699555666
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00743059935601398
ductal carcinoma in situ 1745 0.0081604143151499
Endometriosis 535 0.0203655558061665
esophageal adenocarcinoma 737 0.0290776348282879
spina bifida 1064 0.029769360113588
fibroadenoma 557 0.0389751613007628
Disease Target Count Z-score Confidence
Tooth disease 4 0.0 1.0

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid Arthritis -1.200 0.007
hepatocellular carcinoma 1.100 0.001
esophageal adenocarcinoma -1.900 0.029
psoriasis 2.600 0.000
cutaneous lupus erythematosus 2.200 0.002
osteosarcoma -1.194 0.000
Atopic dermatitis 1.500 0.001
intraductal papillary-mucinous adenoma (... 2.000 0.004
intraductal papillary-mucinous neoplasm ... 2.400 0.007
pancreatic cancer 1.500 0.000
fibroadenoma 1.200 0.039
interstitial cystitis -1.900 0.000
lung adenocarcinoma 1.325 0.004
Endometriosis -1.331 0.020
lung carcinoma -2.900 0.000
spina bifida -1.561 0.030
Breast cancer -2.000 0.000
ductal carcinoma in situ 1.600 0.008
ovarian cancer 2.900 0.000
pituitary cancer -1.800 0.000

Synonym

Accession O60487 A8K2R1
Symbols EVA
EVA1

Gene

  Ortholog (12)

Gene RIF (3)

PMID Text
26930581 CLCA2 links junctional adhesion molecule EVA1, to cytosolic signaling proteins that modulate proliferation and differentiation.
26677976 Findings highlight Eva1 as a novel regulator of GIC function and also provide new mechanistic insight into the role of noncanonical NF-kappaB activation in GIC.
21440040 EVA is expressed in human choroid plexus epithelial cells and CD4 T lymphocytes and regulates CD4+ T lymphocyte adhesion to human choroid plexus epithelial cells in vitro. These data suggest a novel mechanism to regulate CNS immune surveillance.

AA Sequence

MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDG      1 - 70
GPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRL     71 - 140
SVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVY    141 - 210
LEDTD                                                                     211 - 215
//

Text Mined References (12)

PMID Year Title
26930581 2016 CLCA2 Interactor EVA1 Is Required for Mammary Epithelial Cell Differentiation.
26677976 2016 Eva1 Maintains the Stem-like Character of Glioblastoma-Initiating Cells by Activating the Noncanonical NF-?B Signaling Pathway.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21440040 2011 Characterization of epithelial V-like antigen in human choroid plexus epithelial cells: potential role in CNS immune surveillance.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...