Property Summary

NCBI Gene PubMed Count 10
PubMed Score 11.37
PubTator Score 23.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Atopic dermatitis 1.100 3.3e-02
Breast cancer -2.000 3.5e-08
cutaneous lupus erythematosus 2.200 2.4e-03
ductal carcinoma in situ 1.600 8.2e-03
Endometriosis -1.331 2.0e-02
esophageal adenocarcinoma -1.900 2.9e-02
fibroadenoma 1.200 3.9e-02
hepatocellular carcinoma 1.100 7.2e-04
interstitial cystitis -1.500 5.1e-03
intraductal papillary-mucinous adenoma (... 2.000 3.9e-03
intraductal papillary-mucinous neoplasm ... 2.400 7.4e-03
lung adenocarcinoma 1.325 4.4e-03
lung carcinoma -2.900 7.2e-23
osteosarcoma -1.194 8.7e-05
ovarian cancer 1.500 1.4e-09
pancreatic cancer 1.100 1.1e-04
pituitary cancer -1.300 1.7e-03
psoriasis 2.600 1.7e-12
Rheumatoid arthritis -1.200 7.3e-03
spina bifida -1.148 3.6e-02

Gene RIF (3)

AA Sequence

MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDG      1 - 70
GPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRL     71 - 140
SVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVY    141 - 210
LEDTD                                                                     211 - 215
//

Text Mined References (12)

PMID Year Title