Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.96
PubTator Score 2.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.600 1.9e-03
Breast cancer 3.600 2.2e-02
breast carcinoma 1.100 1.7e-14
ductal carcinoma in situ 1.300 8.3e-04
gastric carcinoma 1.200 3.7e-02
group 4 medulloblastoma -1.900 3.0e-06
intraductal papillary-mucinous adenoma (... 1.900 1.0e-02
invasive ductal carcinoma 1.300 2.9e-04
lung carcinoma -1.800 4.4e-22
malignant mesothelioma -1.300 9.2e-07
medulloblastoma, large-cell -2.800 3.7e-04
ovarian cancer -3.500 1.5e-12
pancreatic cancer 1.200 8.6e-04
primary Sjogren syndrome 1.200 2.4e-02
ulcerative colitis 2.000 1.2e-07

AA Sequence

MRPERPRPRGSAPGPMETPPWDPARNDSLPPTLTPAVPPYVKLGLTVVYTVFYALLFVFIYVQLWLVLRY      1 - 70
RHKRLSYQSVFLFLCLFWASLRTVLFSFYFKDFVAANSLSPFVFWLLYCFPVCLQFFTLTLMNLYFTQVI     71 - 140
FKAKSKYSPELLKYRLPLYLASLFISLVFLLVNLTCAVLVKTGNWERKVIVSVRVAINDTLFVLCAVSLS    141 - 210
ICLYKISKMSLANIYLESKGSSVCQVTAIGVTVILLYTSRACYNLFILSFSQNKSVHSFDYDWYNVSDQA    211 - 280
DLKNQLGDAGYVLFGVVLFVWELLPTTLVVYFFRVRNPTKDLTNPGMVPSHGFSPRSYFFDNPRRYDSDD    281 - 350
DLAWNIAPQGLQGGFAPDYYDWGQQTNSFLAQAGTLQDSTLDPDKPSLG                         351 - 399
//

Text Mined References (8)

PMID Year Title