Property Summary

NCBI Gene PubMed Count 40
PubMed Score 43.51
PubTator Score 47.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.100 3.8e-20
glioblastoma 2.400 1.7e-04
intraductal papillary-mucinous adenoma (... -1.400 3.4e-04
malignant mesothelioma -4.000 2.7e-08
medulloblastoma, large-cell -2.000 2.9e-03
osteosarcoma 1.569 5.9e-03
ovarian cancer -5.500 2.7e-19
pituitary cancer -2.500 9.0e-09
psoriasis 1.300 4.0e-03
tuberculosis -2.300 6.6e-06

Gene RIF (21)

AA Sequence

MFAKATRNFLREVDADGDLIAVSNLNDSDKLQLLSLVTKKKRFWCWQRPKYQFLSLTLGDVLIEDQFPSP      1 - 70
VVVESDFVKYEGKFANHVSGTLETALGKVKLNLGGSSRVESQSSFGTLRKQEVDLQQLIRDSAERTINLR     71 - 140
NPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGNVTKDSNVVLE    141 - 210
IPAATTIAYGVIELYVKLDGQFEFCLLRGKQGGFENKKRIDSVYLDPLVFREFAFIDMPDAAHGISSQDG    211 - 280
PLSVLKQATLLLERNFHPFAELPEPQQTALSDIFQAVLFDDELLMVLEPVCDDLVSGLSPTVAVLGELKP    281 - 350
RQQQDLVAFLQLVGCSLQGGCPGPEDAGSKQLFMTAYFLVSALAEMPDSAAALLGTCCKLQIIPTLCHLL    351 - 420
RALSDDGVSDLEDPTLTPLKDTERFGIVQRLFASADISLERLKSSVKAVILKDSKVFPLLLCITLNGLCA    421 - 490
LGREHS                                                                    491 - 496
//

Text Mined References (44)

PMID Year Title