Property Summary

NCBI Gene PubMed Count 4
Grant Count 16
R01 Count 11
Funding $1,928,044.16
PubMed Score 72.76
PubTator Score 20.20

Knowledge Summary

Patent

No data available

AA Sequence

MELSLESLGGLHSVAHAQAGELLSPGHARSAAAQHRGLVAPGRPGLVAGMASLLDGGGGGGGGGAGGAGG      1 - 70
AGSAGGGADFRGELAGPLHPAMGMACEAPGLGGTYTTLTPLQHLPPLAAVADKFHQHAAAAAVAGAHGGH     71 - 140
PHAHPHPAAAPPPPPPPQRLAASVSGSFTLMRDERAALASVGHLYGPYGKELPAMGSPLSPLPNALPPAL    141 - 210
HGAPQPPPPPPPPPLAAYGPPGHLAGDKLLPPAAFEPHAALLGRAEDALARGLPGGGGGTGSGGAGSGSA    211 - 280
AGLLAPLGGLAAAGAHGPHGGGGGPGGSGGGPSAGAAAEEINTKEVAQRITAELKRYSIPQAIFAQRILC    281 - 350
RSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLAACKRKEQEQQKERALQPKKQRLV    351 - 420
FTDLQRRTLIAIFKENKRPSKEMQVTISQQLGLELNTVSNFFMNARRRCMNRWAEEPSTAPGGPAGATAT    421 - 490
FSKA                                                                      491 - 494
//

Text Mined References (4)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.
11944891 2002 OC-3, a novel mammalian member of the ONECUT class of transcription factors.
11181995 2001 The sequence of the human genome.
9915796 1999 OC-2, a novel mammalian member of the ONECUT class of homeodomain transcription factors whose function in liver partially overlaps with that of hepatocyte nuclear factor-6.