Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

Synonym

Accession O60384
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MWLSTSPYRKGSQCGEAFSQIPGHNLNKKTPPGVKPPESHVCGEVGVGYPSTERHIRDRLGRKPCEYQEC      1 - 70
RQKAYTCKPCGNAFRFHHSFHIHERPHSGENLYEC                                        71 - 105
//

Text Mined References (1)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.