Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.3e-05

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.142 1.3e-05

 Compartment GO Term (0)

 GWAS Trait (1)

AA Sequence

MWLSTSPYRKGSQCGEAFSQIPGHNLNKKTPPGVKPPESHVCGEVGVGYPSTERHIRDRLGRKPCEYQEC      1 - 70
RQKAYTCKPCGNAFRFHHSFHIHERPHSGENLYEC                                        71 - 105
//

Text Mined References (1)

PMID Year Title