Property Summary

NCBI Gene PubMed Count 181
PubMed Score 262.63
PubTator Score 273.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
Endometrial cancer 311 0.0 0.5
Liver cancer 604 0.0 0.6
Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 3.0

Expression

  Differential Expression (37)

Disease log2 FC p
acute quadriplegic myopathy 1.315 1.2e-04
adrenocortical carcinoma -1.546 2.0e-04
aldosterone-producing adenoma -1.023 2.1e-02
Amyotrophic lateral sclerosis 1.198 8.1e-06
Astrocytoma, Pilocytic 1.100 8.7e-03
atypical teratoid / rhabdoid tumor -2.000 3.1e-03
autosomal dominant Emery-Dreifuss muscul... 1.290 5.4e-04
breast carcinoma -1.600 3.1e-04
Down syndrome 1.200 1.9e-03
Duchenne muscular dystrophy 1.032 3.6e-07
ductal carcinoma in situ -1.200 1.1e-02
fibroadenoma -1.800 5.3e-03
group 4 medulloblastoma 2.100 5.3e-04
head and neck cancer -1.400 1.8e-02
interstitial cystitis 1.200 8.8e-03
intraductal papillary-mucinous adenoma (... -2.000 1.2e-03
intraductal papillary-mucinous carcinoma... -2.200 7.8e-04
intraductal papillary-mucinous neoplasm ... -2.100 1.4e-02
invasive ductal carcinoma 1.091 1.0e-02
juvenile dermatomyositis 1.004 2.5e-09
lung adenocarcinoma -1.100 4.4e-09
lung cancer -2.100 9.5e-05
lung carcinoma -1.900 1.7e-31
medulloblastoma, large-cell -1.700 2.7e-03
non-small cell lung cancer -1.671 5.5e-17
osteosarcoma 1.435 7.4e-03
ovarian cancer -2.600 6.4e-07
pediatric high grade glioma 1.200 8.2e-03
Pick disease 1.400 7.2e-05
primary Sjogren syndrome 1.300 2.5e-03
primitive neuroectodermal tumor 1.100 6.1e-03
progressive supranuclear palsy -1.700 1.7e-02
psoriasis -1.300 2.0e-04
sarcoidosis 1.200 1.4e-02
subependymal giant cell astrocytoma 1.158 3.6e-02
tuberculosis -1.900 1.7e-04
ulcerative colitis 1.700 5.7e-04

 OMIM Phenotype (1)

Gene RIF (152)

AA Sequence

MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHES      1 - 70
SPHVSQALLPREEEEDEIREGGVEHPWHNNEILQASVDGPEEMKEDYDTMGPEATIQTAINNGTVKNANC     71 - 140
TSDFEEYFAKRKLEERDGHAVSIEEYLQRSDTAIIYPEAPEELSRLGTPEANGQEENDLPPGTPDAFAQL    141 - 210
LTCPYCDRGYKRLTSLKEHIKYRHEKNEENFSCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNR    211 - 280
KFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKT    281 - 350
GSSPNSVSSSPTNSAITQLRNKLENGKPLSMSEQTGLLKIKTEPLDFNDYKVLMATHGFSGTSPFMNGGL    351 - 420
GATSPLGVHPSAQSPMQHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKAEEISKLKGYH    421 - 490
MKDPCSQPEEQGVTSPNIPPVGLPVVSHNGATKSIIDYTLEKVNEAKACLQSLTTDSRRQISNIKKEKLR    491 - 560
TLIDLVTDDKMIENHNISTPFSCQFCKESFPGPIPLHQHERYLCKMNEEIKAVLQPHENIVPNKAGVFVD    561 - 630
NKALLLSSVLSEKGMTSPINPYKDHMSVLKAYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQY    631 - 700
SNSRSPSLERSSKPLAPNSNPPTKDSLLPRSPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIK    701 - 770
PVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKAS    771 - 840
SISLDHNSVSSSSENSDEPLNLTFIKKEFSNSNNLDNKSTNPVFSMNPFSAKPLYTALPPQSAFPPATFM    841 - 910
PPVQTSIPGLRPYPGLDQMSFLPHMAYTYPTGAATFADMQQRRKYQRKQGFQGELLDGAQDYMSGLDDMT    911 - 980
DSDSCLSRKKIKKTESGMYACDLCDKTFQKSSSLLRHKYEHTGKRPHQCQICKKAFKHKHHLIEHSRLHS    981 - 1050
GEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEEREAAEREAREKGHLEPTELLMNRAYLQSITPQG   1051 - 1120
YSDSEERESMPRDGESEKEHEKEGEDGYGKLGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSM   1121 - 1190
DDSSEDGKMETKSDHEEDNMEDGM                                                 1191 - 1214
//

Text Mined References (188)

PMID Year Title