Property Summary

NCBI Gene PubMed Count 166
Grant Count 70
R01 Count 43
Funding $4,039,618.88
PubMed Score 228.80
PubTator Score 273.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (56)

Disease Z-score Confidence
Mowat-Wilson syndrome 12 7.523 3.8
Hirschsprung's disease 42 5.556 2.8
Cancer 2,346 4.66 2.3
Intellectual disability 573 4.377 2.2
Microcephaly 149 4.217 2.1
Hypospadias 65 3.904 2.0
Congenital heart disease 63 3.779 1.9
Epilepsy 346 3.194 1.6
PITT-HOPKINS SYNDROME 21 3.16 1.6
Amyotrophic Lateral Sclerosis 431
Carcinoma 2,147 1.0
Congenital Heart Defects 37
Disease Progression 125
Down syndrome 548
Duchenne muscular dystrophy 602
Kidney cancer 118 2.0
Mammary Neoplasms 410
Myopia 99
Neoplasm Invasiveness 127
Neoplastic Cell Transformation 81
Pick disease 1,893
Renal Cell Carcinoma 199
Schizophrenia 501
acute quadriplegic myopathy 1,157
adrenocortical carcinoma 1,427
aldosterone-producing adenoma 664
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
ductal carcinoma in situ 1,745
fibroadenoma 557
group 4 medulloblastoma 1,875
head and neck cancer 270
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
primary Sjogren syndrome 789
primitive neuroectodermal tumor 3,031
progressive supranuclear palsy 674
psoriasis 6,685
sarcoidosis 358
subependymal giant cell astrocytoma 2,287
tuberculosis 1,557
ulcerative colitis 2,087

Expression

Synonym

Accession O60315 A0JP09 B7Z2P2 F5H814 Q9UED1
Symbols SIP1
SIP-1
ZFHX1B
HSPC082
SMADIP1

Gene

PDB

2DA7  

 GO Component (1)

Gene RIF (137)

PMID Text
26852091 Report of the first confirmed cases of Mowat Wilson syndrome in three children with the typical facial features, mental retardation, absent corpus callosum, epilepsy, and Hirschsprung's disease and novel Zeb2 variations on DNA analysis.
26823172 suggest that deltaEF1 family proteins promote cell motility of breast cancer cells directly or indirectly through repressing expression of RGS16
26662405 MicroRNA-215 functions as a tumor suppressor and directly targets ZEB2 in human pancreatic cancer
26654950 This is the first study claiming the association of the genetic risks of rs6755392 in the ZEB2 gene with schizophrenia.
26648487 restoration of ZEB2 effectively reversed the Reduced expression of ZEB2, as well as the suppressive effects of miR200b overexpression on the proliferation.
26646296 Bioinformatics analyses showed that miR-138 targeted the 3'-UTR of ZEB2 mRNA to inhibit its translation. Furthermore, miR-138 overexpression inhibited ZEB2-mediated cell invasion and metastases, while miR-138 depletion increased ZEB2-mediated cell invasion and metastases in BC cells
26556542 Our study first indicates that miR-590-3p functions as a suppressor of GBM EMT and metastasis by targeting ZEB1 and ZEB2, and it may be a therapeutic target for metastatic GBM.
26503460 restoration of expression of ZEB2 weakened miR-154-mediated suppression of tumor progression. miR-154 functions as a tumor suppressor in HCC by suppressing ZEB2, suggesting that miR-154 may serve as a potential target for HCC.
26461224 High ZEB2 expression is associated with clear cell kidney carcinoma.
26378039 Results establish that the dowregulation of GADD45G-SIP1 axis may contribute to cellular senescence evasion and HCC development.
More...

AA Sequence

MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHES      1 - 70
SPHVSQALLPREEEEDEIREGGVEHPWHNNEILQASVDGPEEMKEDYDTMGPEATIQTAINNGTVKNANC     71 - 140
TSDFEEYFAKRKLEERDGHAVSIEEYLQRSDTAIIYPEAPEELSRLGTPEANGQEENDLPPGTPDAFAQL    141 - 210
LTCPYCDRGYKRLTSLKEHIKYRHEKNEENFSCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNR    211 - 280
KFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKT    281 - 350
GSSPNSVSSSPTNSAITQLRNKLENGKPLSMSEQTGLLKIKTEPLDFNDYKVLMATHGFSGTSPFMNGGL    351 - 420
GATSPLGVHPSAQSPMQHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKAEEISKLKGYH    421 - 490
MKDPCSQPEEQGVTSPNIPPVGLPVVSHNGATKSIIDYTLEKVNEAKACLQSLTTDSRRQISNIKKEKLR    491 - 560
TLIDLVTDDKMIENHNISTPFSCQFCKESFPGPIPLHQHERYLCKMNEEIKAVLQPHENIVPNKAGVFVD    561 - 630
NKALLLSSVLSEKGMTSPINPYKDHMSVLKAYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQY    631 - 700
SNSRSPSLERSSKPLAPNSNPPTKDSLLPRSPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIK    701 - 770
PVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKAS    771 - 840
SISLDHNSVSSSSENSDEPLNLTFIKKEFSNSNNLDNKSTNPVFSMNPFSAKPLYTALPPQSAFPPATFM    841 - 910
PPVQTSIPGLRPYPGLDQMSFLPHMAYTYPTGAATFADMQQRRKYQRKQGFQGELLDGAQDYMSGLDDMT    911 - 980
DSDSCLSRKKIKKTESGMYACDLCDKTFQKSSSLLRHKYEHTGKRPHQCQICKKAFKHKHHLIEHSRLHS    981 - 1050
GEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEEREAAEREAREKGHLEPTELLMNRAYLQSITPQG   1051 - 1120
YSDSEERESMPRDGESEKEHEKEGEDGYGKLGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSM   1121 - 1190
DDSSEDGKMETKSDHEEDNMEDGM                                                 1191 - 1214
//

Text Mined References (172)

PMID Year Title
26852091 2016 Novel Zeb2 gene variation in the Mowat Wilson syndrome (MWS).
26823172 2016 The potential role of regulator of G-protein signaling 16 in cell motility mediated by ?EF1 family proteins.
26662405 2015 MicroRNA-215 functions as a tumor suppressor and directly targets ZEB2 in human pancreatic cancer.
26654950 2016 A new risk locus in the ZEB2 gene for schizophrenia in the Han Chinese population.
26648487 2016 MicroRNA-200b inhibits the growth and metastasis of glioma cells via targeting ZEB2.
26646296 2015 MicroRNA-138 Regulates Metastatic Potential of Bladder Cancer Through ZEB2.
26556542 2015 miR-590-3p suppresses cancer cell migration, invasion and epithelial-mesenchymal transition in glioblastoma multiforme by targeting ZEB1 and ZEB2.
26503460 2015 miR-154 targeting ZEB2 in hepatocellular carcinoma functions as a potential tumor suppressor.
26461224 2015 LncRNA MALAT1 functions as a competing endogenous RNA to regulate ZEB2 expression by sponging miR-200s in clear cell kidney carcinoma.
26378039 2015 SIP1 is a downstream effector of GADD45G in senescence induction and growth inhibition of liver tumor cells.
More...