Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.34
PubTator Score 5.44

Knowledge Summary

Patent (1,278)

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
astrocytoma -1.900 0.000
ependymoma -2.400 0.000
glioblastoma -3.100 0.000
oligodendroglioma -2.000 0.000
osteosarcoma -2.327 0.000
medulloblastoma -3.100 0.000
atypical teratoid / rhabdoid tumor -3.100 0.000
medulloblastoma, large-cell -3.700 0.000
primitive neuroectodermal tumor -2.700 0.001
tuberculosis 1.200 0.000
pediatric high grade glioma -2.400 0.000
pilocytic astrocytoma -2.000 0.000
Pick disease -1.100 0.040

Gene RIF (1)

PMID Text
18650832 A single-nucleotide polymorphism (SNP)located in the second intron of the MAST3 gene is found to be associated in the screening and replication inflammatory bowel disease cohorts.

AA Sequence

MDESSLLRRRGLQKELSLPRRGRGCRSGNRKSLVVGTPSPTLSRPLSPLSVPTAGSSPLDSPRNFSAASA      1 - 70
LNFPFARRADGRRWSLASLPSSGYGTNTPSSTLSSSSSSRERLHQLPFQPTPDELHFLSKHFRSSENVLD     71 - 140
EEGGRSPRLRPRSRSLSPGRATGTFDNEIVMMNHVYRERFPKATAQMEGRLQEFLTAYAPGARLALADGV    141 - 210
LGFIHHQIVELARDCLAKSGENLVTSRYFLEMQEKLERLLQDAHERSDSEEVSFIVQLVRKLLIIISRPA    211 - 280
RLLECLEFDPEEFYHLLEAAEGHAREGQGIKTDLPQYIIGQLGLAKDPLEEMVPLSHLEEEQPPAPESPE    281 - 350
SRALVGQSRRKPCESDFETIKLISNGAYGAVYLVRHRDTRQRFAIKKINKQNLILRNQIQQVFVERDILT    351 - 420
FAENPFVVSMFCSFETRRHLCMVMEYVEGGDCATLLKNMGPLPVDMARLYFAETVLALEYLHNYGIVHRD    421 - 490
LKPDNLLITSLGHIKLTDFGLSKIGLMSMATNLYEGHIEKDAREFIDKQVCGTPEYIAPEVIFRQGYGKP    491 - 560
VDWWAMGVVLYEFLVGCVPFFGDTPEELFGQVVSDEIMWPEGDEALPADAQDLITRLLRQSPLDRLGTGG    561 - 630
THEVKQHPFFLALDWAGLLRHKAEFVPQLEAEDDTSYFDTRSERYRHLGSEDDETNDEESSTEIPQFSSC    631 - 700
SHRFSKVYSSSEFLAVQPTPTFAERSFSEDREEGWERSEVDYGRRLSADIRLRSWTSSGSSCQSSSSQPE    701 - 770
RGPSPSLLNTISLDTMPKFAFSSEDEGVGPGPAGPKRPVFILGEPDPPPAATPVMPKPSSLSADTAALSH    771 - 840
ARLRSNSIGARHSTPRPLDAGRGRRLGGPRDPAPEKSRASSSGGSGGGSGGRVPKSASVSALSLIITADD    841 - 910
GSGGPLMSPLSPRSLSSNPSSRDSSPSRDPSPVCGSLRPPIVIHSSGKKYGFSLRAIRVYMGDSDVYTVH    911 - 980
HVVWSVEDGSPAQEAGLRAGDLITHINGESVLGLVHMDVVELLLKSGNKISLRTTALENTSIKVGPARKN    981 - 1050
VAKGRMARRSKRSRRRETQDRRKSLFKKISKQTSVLHTSRSFSSGLHHSLSSSESLPGSPTHSLSPSPTT   1051 - 1120
PCRSPAPDVPADTTASPPSASPSSSSPASPAAAGHTRPSSLHGLAAKLGPPRPKTGRRKSTSSIPPSPLA   1121 - 1190
CPPISAPPPRSPSPLPGHPPAPARSPRLRRGQSADKLGTGERLDGEAGRRTRGPEAELVVMRRLHLSERR   1191 - 1260
DSFKKQEAVQEVSFDEPQEEATGLPTSVPQIAVEGEEAVPVALGPTGRD                        1261 - 1309
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18650832 2008 MAST3: a novel IBD risk factor that modulates TLR4 signaling.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...