Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.98
PubTator Score 2.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active ulcerative colitis 1.509 7.0e-03
adult high grade glioma -1.800 5.0e-06
Astrocytoma, Pilocytic -1.900 6.7e-11
atypical teratoid / rhabdoid tumor -2.800 1.2e-12
colon cancer 1.200 4.0e-03
ependymoma -1.800 9.8e-15
glioblastoma -1.900 1.2e-10
group 3 medulloblastoma -2.500 1.3e-05
medulloblastoma, large-cell -2.700 3.3e-05
ovarian cancer 1.900 1.2e-09
primitive neuroectodermal tumor -1.700 2.5e-04
subependymal giant cell astrocytoma -1.595 1.3e-02
tuberculosis -1.300 9.5e-05

Gene RIF (1)

AA Sequence

MAKLETLPVRADPGRDPLLAFAPRPSELGPPDPRLAMGSVGSGVAHAQEFAMKSVGTRTGGGGSQGSFPG      1 - 70
PRGSGSGASRERPGRYPSEDKGLANSLYLNGELRGSDHTDVCGNVVGSSGGSSSSGGSDKAPPQYREPSH     71 - 140
PPKLLATSGKLDQCSEPLVRPSAFKPVVPKNFHSMQNLCPPQTNGTPEGRQGPGGLKGGLDKSRTMTPAG    141 - 210
GSGSGLSDSGRNSLTSLPTYSSSYSQHLAPLSASTSHINRIGTASYGSGSGGSSGGGSGYQDLGTSDSGR    211 - 280
ASSKSGSSSSMGRPGHLGSGEGGGGGLPFAACSPPSPSALIQELEERLWEKEQEVAALRRSLEQSEAAVA    281 - 350
QVLEERQKAWERELAELRQGCSGKLQQVARRAQRAQQGLQLQVLRLQQDKKQLQEEAARLMRQREELEDK    351 - 420
VAACQKEQADFLPRIEETKWEVCQKAGEISLLKQQLKDSQADVSQKLSEIVGLRSQLREGRASLREKEEQ    421 - 490
LLSLRDSFSSKQASLELGEGELPAACLKPALTPVDPAEPQDALATCESDEAKMRRQAGVAAAASLVSVDG    491 - 560
EAEAGGESGTRALRREVGRLQAELAAERRARERQGASFAEERRVWLEEKEKVIEYQKQLQLSYVEMYQRN    561 - 630
QQLERRLRERGAAGGASTPTPQHGEEKKAWTPSRLERIESTEI                               631 - 673
//

Text Mined References (8)

PMID Year Title