Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.95
PubTator Score 19.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -3.600 0.000
ependymoma -3.400 0.029
astrocytoma -1.600 0.000
glioblastoma multiforme -1.800 0.000
oligodendroglioma -1.700 0.000
group 4 medulloblastoma 4.600 0.000
lung cancer 1.800 0.002
pediatric high grade glioma -2.000 0.023
atypical teratoid/rhabdoid tumor -2.100 0.022
pilocytic astrocytoma -2.900 0.001
non primary Sjogren syndrome sicca -1.200 0.019
subependymal giant cell astrocytoma -5.157 0.003
lung carcinoma 5.700 0.000
progressive supranuclear palsy -2.200 0.021
pituitary cancer -2.600 0.003
Down syndrome 1.800 0.001

Synonym

Accession O60284 Q17RY1
Symbols NZF3
ZNF387
ZC2H2C3
ZC2HC10

Gene

PDB

2CS8  

Gene RIF (7)

PMID Text
24509857 ST18 expression and activity are increased in cytotoxic conditions in pancreatic beta-cells. Overexpression of ST18 causes apoptosis.
23847314 In our study, rs1015213 (located in the intergenic region between PCMTD1 and ST18) was associated significantly with primary angle closure.
23505305 Presence of at least one A allele (AG or AA genotype) for rs1015213 was associated with a shallower anterior chamber depth (-0.07 mm, 95% CI -0.01 to -0.14 mm, p=0.028) after adjusting for age and sex (both p</=0.001).
22437316 a significant association between ST18 and predisposition to Pemphigus vulgaris (PV).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676404 Fibroblasts that overexpress ST18 by transient transfection exhibit significantly increased apoptosis and increased expression of TNF-alpha, interleukin (IL) -1alpha, and IL-6.
15489893 ectopic ST18 expression in MCF-7 breast cancer cells strongly inhibits colony formation in soft agar and the formation of tumors in a xenograft mouse model

AA Sequence

MDAEAEDKTLRTRSKGTEVPMDSLIQELSVAYDCSMAKKRTAEDQALGVPVNKRKSLLMKPRHYSPKADC      1 - 70
QEDRSDRTEDDGPLETHGHSTAEEIMIKPMDESLLSTAQENSSRKEDRYSCYQELMVKSLMHLGKFEKNV     71 - 140
SVQTVSENLNDSGIQSLKAESDEADECFLIHSDDGRDKIDDSQPPFCSSDDNESNSESAENGWDSGSNFS    141 - 210
EETKPPRVPKYVLTDHKKDLLEVPEIKTEGDKFIPCENRCDSETERKDPQNALAEPLDGNAQPSFPDVEE    211 - 280
EDSESLAVMTEEGSDLEKAKGNLSLLEQAIALQAERGCVFHNTYKELDRFLLEHLAGERRQTKVIDMGGR    281 - 350
QIFNNKHSPRPEKRETKCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGR    351 - 420
GHVNSNRNTHRSLSGCPIAAAEKLAMSQDKNQLDSPQTGQCPDQAHRTSLVKQIEFNFPSQAITSPRATV    421 - 490
SKEQEKFGKVPFDYASFDAQVFGKRPLIQTVQGRKTPPFPESKHFPNPVKFPNRLPSAGAHTQSPGRASS    491 - 560
YSYGQCSEDTHIAAAAAILNLSTRCREATDILSNKPQSLHAKGAEIEVDENGTLDLSMKKNRILDKSAPL    561 - 630
TSSNTSIPTPSSSPFKTSSILVNAAFYQALCDQEGWDTPINYSKTHGKTEEEKEKDPVSSLENLEEKKFP    631 - 700
GEASIPSPKPKLHARDLKKELITCPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPT    701 - 770
PGCDGSGHVTGNYASHRSLSGCPRARKGGVKMTPTKEEKEDPELKCPVIGCDGQGHISGKYTSHRTASGC    771 - 840
PLAAKRQKENPLNGASLSWKLNKQELPHCPLPGCNGLGHVNNVFVTHRSLSGCPLNAQVIKKGKVSEELM    841 - 910
TIKLKATGGIESDEEIRHLDEEIKELNESNLKIEADMMKLQTQITSMESNLKTIEEENKLIEQNNESLLK    911 - 980
ELAGLSQALISSLADIQLPQMGPISEQNFEAYVNTLTDMYSNLERDYSPECKALLESIKQAVKGIHV       981 - 1047
//

Text Mined References (13)

PMID Year Title
24509857 2014 A critical role for the neural zinc factor ST18 in pancreatic ?-cell apoptosis.
23847314 2013 Association study in a South Indian population supports rs1015213 as a risk factor for primary angle closure.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23505305 2013 Genotype-phenotype analysis of SNPs associated with primary angle closure glaucoma (rs1015213, rs3753841 and rs11024102) and ocular biometry in the EPIC-Norfolk Eye Study.
22437316 2012 Population-specific association between a polymorphic variant in ST18, encoding a pro-apoptotic molecule, and pemphigus vulgaris.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18676404 2008 The transcription factor ST18 regulates proapoptotic and proinflammatory gene expression in fibroblasts.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489893 2004 ST18 is a breast cancer tumor suppressor gene at human chromosome 8q11.2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...