Property Summary

NCBI Gene PubMed Count 17
PubMed Score 25.50
PubTator Score 16.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Progressive muscular atrophy 7 3.446 1.7
Paraplegia 74 3.14 1.6

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.100 4.0e-03
astrocytic glioma -1.600 2.2e-02
Astrocytoma, Pilocytic -1.800 1.1e-05
atypical teratoid / rhabdoid tumor -1.300 3.1e-04
Breast cancer 3.500 2.2e-02
colon cancer -1.700 1.8e-02
ependymoma -2.500 1.3e-02
facioscapulohumeral dystrophy 1.800 7.7e-03
fibroadenoma 1.900 1.3e-03
glioblastoma -2.500 3.6e-08
group 3 medulloblastoma -1.400 1.0e-02
interstitial cystitis -2.800 2.5e-04
intraductal papillary-mucinous adenoma (... -1.400 3.4e-02
intraductal papillary-mucinous carcinoma... -1.200 3.8e-02
lung cancer 1.700 1.8e-04
lung carcinoma 4.800 9.1e-58
medulloblastoma, large-cell -2.200 1.1e-02
oligodendroglioma -1.300 2.9e-02
ovarian cancer 1.800 2.5e-02
Pick disease 1.100 1.5e-03
pituitary cancer -1.700 6.7e-06

Gene RIF (7)

AA Sequence

MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQI      1 - 70
VKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYL     71 - 140
DKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFL    141 - 210
INIKQENVETEKKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYR    211 - 280
DSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEK    281 - 350
EKNKTLKNVIQHLEMELNRWRNGEAVPEDEQISAKDQKNLEPCDNTPIIDNIAPVVAGISTEEKEKYDEE    351 - 420
ISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAAKDEVKEVLQA    421 - 490
LEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELSNHQKKRATEILNLLLKDLGE    491 - 560
IGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKSLVNRSKQLESAQMDSNRKMNASERELAACQ    561 - 630
LLISQHEAKIKSLTDYMQNMEQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMK    631 - 700
KALEQQMESHREAHQKQLSRLRDEIEEKQKIIDEIRDLNQKLQLEQEKLSSDYNKLKIEDQEREMKLEKL    701 - 770
LLLNDKREQAREDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKKSVELDNDDGGGSAAQKQKISFLENN    771 - 840
LEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQEVDRIKEAVRA    841 - 910
KNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGSSSNSTHYQK                           911 - 957
//

Text Mined References (22)

PMID Year Title