Property Summary

NCBI Gene PubMed Count 16
PubMed Score 22.44
PubTator Score 16.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 9.14789413959007E-58
posterior fossa group A ependymoma 1511 2.53609309204949E-13
pituitary cancer 1972 4.08430059958748E-7
atypical teratoid / rhabdoid tumor 4369 1.86994378072432E-6
interstitial cystitis 2299 3.57662970629483E-6
pediatric high grade glioma 2712 9.46473911503897E-6
pilocytic astrocytoma 3086 1.10970322424579E-5
group 4 medulloblastoma 1875 3.27277584987582E-5
colon cancer 1475 8.42724506494392E-5
lung cancer 4473 8.71816245847824E-5
Pick disease 1893 1.89723501314062E-4
astrocytoma 1493 4.15446970780036E-4
glioblastoma 5572 0.00117795100640224
fibroadenoma 557 0.00133538026366642
facioscapulohumeral dystrophy 286 0.00771168330964135
medulloblastoma, large-cell 6234 0.0107400469937142
Breast cancer 3099 0.0215510499526643
ovarian cancer 8492 0.02533358135317
oligodendroglioma 2849 0.0293232459394465
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0337332758501589
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0470327671236699
Disease Target Count Z-score Confidence
Progressive muscular atrophy 6 3.485 1.7
Paraplegia 71 3.34 1.7

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytoma -3.000 0.000
posterior fossa group A ependymoma -2.900 0.000
oligodendroglioma -1.300 0.029
glioblastoma -3.200 0.001
group 4 medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -3.300 0.000
medulloblastoma, large-cell -2.200 0.011
intraductal papillary-mucinous adenoma (... -1.400 0.034
intraductal papillary-mucinous carcinoma... -1.500 0.047
colon cancer -2.900 0.000
lung cancer 3.900 0.000
fibroadenoma 1.900 0.001
Breast cancer 3.500 0.022
interstitial cystitis -3.200 0.000
pediatric high grade glioma -2.600 0.000
pilocytic astrocytoma -1.900 0.000
lung carcinoma 4.800 0.000
Pick disease -1.200 0.000
ovarian cancer 1.800 0.025
pituitary cancer -2.100 0.000
facioscapulohumeral dystrophy 1.800 0.008

Synonym

Accession O60282 O95079 Q2YDC5
Symbols KINN
NKHC
NKHC2
CDCBM2
NKHC-2

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
24812067 Genetic association of KIF4A and KIF5C mutations in intellectual disability and synaptic function.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19011756 Results identified the motor neuron protein KIF5C as a new binding partner for the protein kinase CK2alpha'.
18682247 KIF5C, a member of the kinesin 1 heavy chain family, is a substrate for protein kinase CK2.
17887960 binding of the kinesin-binding domain of RanBP2 to KIF5B and KIF5C determines mitochondria localization and function
16835241 analysis of the GRIF-1 binding domain of the kinesin, KIF5C, which substantiates a role for GRIF-1 as an adaptor protein in the anterograde trafficking of cargoes

AA Sequence

MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQI      1 - 70
VKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYL     71 - 140
DKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFL    141 - 210
INIKQENVETEKKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYR    211 - 280
DSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEK    281 - 350
EKNKTLKNVIQHLEMELNRWRNGEAVPEDEQISAKDQKNLEPCDNTPIIDNIAPVVAGISTEEKEKYDEE    351 - 420
ISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAAKDEVKEVLQA    421 - 490
LEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELSNHQKKRATEILNLLLKDLGE    491 - 560
IGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKSLVNRSKQLESAQMDSNRKMNASERELAACQ    561 - 630
LLISQHEAKIKSLTDYMQNMEQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMK    631 - 700
KALEQQMESHREAHQKQLSRLRDEIEEKQKIIDEIRDLNQKLQLEQEKLSSDYNKLKIEDQEREMKLEKL    701 - 770
LLLNDKREQAREDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKKSVELDNDDGGGSAAQKQKISFLENN    771 - 840
LEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQEVDRIKEAVRA    841 - 910
KNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGSSSNSTHYQK                           911 - 957
//

Text Mined References (21)

PMID Year Title
24812067 2014 Involvement of the kinesin family members KIF4A and KIF5C in intellectual disability and synaptic function.
23603762 2013 Mutations in TUBG1, DYNC1H1, KIF5C and KIF2A cause malformations of cortical development and microcephaly.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19135897 2009 The mechanism of Ca2+ -dependent regulation of kinesin-mediated mitochondrial motility.
19011756 2009 KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit.
18682247 2008 The kinesin I family member KIF5C is a novel substrate for protein kinase CK2.
17887960 2007 Association of the kinesin-binding domain of RanBP2 to KIF5B and KIF5C determines mitochondria localization and function.
More...