Property Summary

NCBI Gene PubMed Count 576
Grant Count 490
R01 Count 215
Funding $82,250,920.05
PubMed Score 955.51
PubTator Score 567.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.000

Synonym

Accession O60260 A3FG77 A8K975 D3JZW7 D3K2X0 Q5TFV8 Q5VVX4 Q6Q2I6 Q8NI41 Q8NI43 Q8NI44 Q8WW07 Parkin
Symbols PDJ
PRKN
AR-JP
LPRS2

Gene

PANTHER Protein Class (2)

PDB

1IYF   2JMO   4BM9   4I1F   4I1H   5C1Z   5C23   5C9V  

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
720549 other 23 / 40 / 84 qHTS for Inhibitors of Bloom's syndrome helicase (BLM): Helicase ATPase Orthogonal Confirmatory Assay for SAR
720555 other 73 / 30 / 45 qHTS for Inhibitors of Bloom's syndrome helicase (BLM): Helicase DNA unwinding fluorescent orthogonal confirmatory assay for SAR
720571 summary 0 / 0 / 0 qHTS for Modulators of Parkin Expression: Summary
720572 confirmatory 14 / 49 / 1214 qHTS for Activators of Parkin Expression: LOPAC Validation Assay (NLuc Reporter)
720573 confirmatory 12 / 51 / 1214 qHTS for Activators of Parkin Expression: LOPAC Validation Assay (FLuc Reporter)

Gene RIF (533)

PMID Text
26975375 Ubiquitylation of PKM2 by parkin does not affect its stability but decreases its enzymatic activity.
26928937 These studies provide valuable insight into the roles, and cellular hierarchy, of distinct phosphorylation events in parkin activation, and profiles mutations in Parkinson's patients.
26911690 A role was established for Parkin in regulating the endo-lysomal pathway.
26683220 Results show an important role for PARK2 as a tumor suppressor both in melanoma predisposition and progression, which could explain the molecular mechanism behind the epidemiological association of melanoma and Parkinson disease.
26631732 UBL domain specifically interacts with the R1 domain and negatively regulates Parkin E3 ligase activity.
26519280 Fibroblasts isolated from skin biopsy specimens from patients with genetic forms of Parkinson's disease, carriers of mutations in LRRK2 and PARK2 genes, and from a healthy volunteer were reprogrammed into induced pluripotent stem cells.
26465922 Differential expression of parkin in multiple system atrophy brains was found compared to control and Parkinson's disease brains.
26387737 Data indicates that Parkin regulates mitotic progression and its deficiency results in multiple mitotic defects, genomic instability, and tumorigenesis suggesting a role as tumor suppressor.
26377470 The human parkin Q311X mutation impacts on mitochondrial quality control via PARIS-mediated regulation of PGC1alpha-TFEB signaling in transgenic mice.
26354775 Some patients with Hurthle cell tumors harbored a tumor-specific mutation in Parkin (V380L).
More...

AA Sequence

MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV      1 - 70
QRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGR     71 - 140
SIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFF    141 - 210
KCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHD    211 - 280
PQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKV    281 - 350
TCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPR    351 - 420
CHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV                             421 - 465
//

Text Mined References (584)

PMID Year Title
26975375 2016 Parkin Regulates the Activity of Pyruvate Kinase M2.
26928937 2016 Probes of ubiquitin E3 ligases enable systematic dissection of parkin activation.
26911690 2016 Parkin Modulates Endosomal Organization and Function of the Endo-Lysosomal Pathway.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26683220 2016 PARKIN Inactivation Links Parkinson's Disease to Melanoma.
26631732 2016 Interaction between RING1 (R1) and the Ubiquitin-like (UBL) Domains Is Critical for the Regulation of Parkin Activity.
26519280 2015 Phenotypical Differences in Neuronal Cultures Derived via Reprogramming the Fibroblasts from Patients Carrying Mutations in Parkinsonian Genes LRRK2 and PARK2.
26465922 2016 Altered ?-synuclein, parkin, and synphilin isoform levels in multiple system atrophy brains.
26387737 2015 Parkin Regulates Mitosis and Genomic Stability through Cdc20/Cdh1.
26377470 2015 Mitochondrial Quality Control via the PGC1?-TFEB Signaling Pathway Is Compromised by Parkin Q311X Mutation But Independently Restored by Rapamycin.
More...