Property Summary

NCBI Gene PubMed Count 20
Grant Count 5
R01 Count 5
Funding $260,439.66
PubMed Score 21.12
PubTator Score 12.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
esophageal adenocarcinoma -1.500 0.018
medulloblastoma, large-cell -1.400 0.000
non-small cell lung cancer 1.731 0.000
interstitial cystitis -1.600 0.001

Gene RIF (3)

PMID Text
23318427 Results indicate that the expression of SOX15 in pancreatic cancer cell lines with undetectable expression resulted in reduced viability of cancer cells both in vitro and in vivo demonstrating its tumor suppressive capability.
18579725 The gain of function studies indicated that sex-determining region Y (SRY)-box 15 (SOX15) activate NR5A1 gene expression.
18182846 We established stable NT2/D1 cell lines overexpressing SOX15 (SOX15-NT2/D1), and a modified 3-(4,5-dime-thylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay showed that the SOX15-NT2/D1 cells exhibited significantly slower growth than controls

AA Sequence

MALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVKRPMNAFMVWSSAQRRQMAQQ      1 - 70
NPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRRKAKSSGAGPSRCGQGRGN     71 - 140
LASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCSLPQSDPRLQGELLPTYTHY    141 - 210
LPPGSPTPYNPPLAGAPMPLTHL                                                   211 - 233
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23318427 2014 SOX15 is a candidate tumor suppressor in pancreatic cancer with a potential role in Wnt/?-catenin signaling.
22197929 2011 A genome-wide association study in Han Chinese identifies multiple susceptibility loci for IgA nephropathy.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
18579725 2008 Identification of NR5A1 (SF-1/AD4BP) gene expression modulators by large-scale gain and loss of function studies.
18182846 2007 Overexpression of SOX15 inhibits proliferation of NT2/D1 cells derived from a testicular embryonal cell carcinoma.
17363903 2007 Sox15 and Fhl3 transcriptionally coactivate Foxk1 and regulate myogenic progenitor cells.
16759287 2006 Sox15 enhances trophoblast giant cell differentiation induced by Hand1 in mouse placenta.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...