Property Summary

NCBI Gene PubMed Count 21
PubMed Score 23.31
PubTator Score 12.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
esophageal adenocarcinoma -1.500 1.8e-02
interstitial cystitis -1.500 5.1e-03
malignant mesothelioma 2.300 4.5e-08
medulloblastoma, large-cell -1.400 1.6e-04
non-small cell lung cancer 1.731 2.4e-10

Synonym

Accession O60248 B4DWU7 D3DTQ0 P35717 Q9Y6W7
Symbols SOX20
SOX26
SOX27

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVKRPMNAFMVWSSAQRRQMAQQ      1 - 70
NPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRRKAKSSGAGPSRCGQGRGN     71 - 140
LASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCSLPQSDPRLQGELLPTYTHY    141 - 210
LPPGSPTPYNPPLAGAPMPLTHL                                                   211 - 233
//

Text Mined References (24)

PMID Year Title