Property Summary

NCBI Gene PubMed Count 12
PubMed Score 59.72
PubTator Score 29.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
HYPOGONADOTROPIC HYPOGONADISM 15 WITH OR WITHOUT ANOSMIA 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Klinefelter's syndrome 56 0.0 4.0
Disease Target Count Z-score Confidence
Liver disease 237 3.429 1.7
Hereditary spherocytosis type 2 18 3.021 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma 1.200 6.8e-03
cystic fibrosis -1.717 1.4e-06
group 3 medulloblastoma -1.200 1.7e-03
intraductal papillary-mucinous adenoma (... -1.400 1.3e-05
intraductal papillary-mucinous carcinoma... -1.100 4.2e-02
medulloblastoma, large-cell -1.400 5.0e-05
ovarian cancer 1.300 9.6e-05

Gene RIF (5)

AA Sequence

MRRRRAGGRTMVERASKFVLVVAGSVCFMLILYQYAGPGLSLGAPGGRAPPDDLDLFPTPDPHYEKKYYF      1 - 70
PVRELERSLRFDMKGDDVIVFLHIQKTGGTTFGRHLVQNVRLEVPCDCRPGQKKCTCYRPNRRETWLFSR     71 - 140
FSTGWSCGLHADWTELTNCVPGVLDRRDSAALRTPRKFYYITLLRDPVSRYLSEWRHVQRGATWKTSLHM    141 - 210
CDGRTPTPEELPPCYEGTDWSGCTLQEFMDCPYNLANNRQVRMLADLSLVGCYNLSFIPEGKRAQLLLES    211 - 280
AKKNLRGMAFFGLTEFQRKTQYLFERTFNLKFIRPFMQYNSTRAGGVEVDEDTIRRIEELNDLDMQLYDY    281 - 350
AKDLFQQRYQYKRQLERREQRLRSREERLLHRAKEALPREDADEPGRVPTEDYMSHIIEKW             351 - 411
//

Text Mined References (13)

PMID Year Title