Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.33
PubTator Score 269.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 4.2e-11
ovarian cancer 8520 2.1e-05
Multiple myeloma 1332 1.2e-03
Disease Target Count Z-score Confidence
Fasciitis 3 3.707 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.200 4.2e-11
Multiple myeloma 1.205 1.2e-03
ovarian cancer 1.300 2.1e-05

Gene RIF (3)

AA Sequence

MALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTILLQDKQRKIYC      1 - 70
VACQELDSDVDKDNPALNAQAALSQAREHQLASASELPLGSRPAPQPPVPRPEHCEGAAAGLKAAQGPPA     71 - 140
PAVPPNTDVMACTQTALLQKLTWASAELGSSTSLETSIQLCGLIRACAEALRSLQQLQH               141 - 199
//

Text Mined References (18)

PMID Year Title