Property Summary

NCBI Gene PubMed Count 148
PubMed Score 588.74
PubTator Score 281.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.100 2.4e-02
Breast cancer 2.700 5.2e-04
breast carcinoma 1.500 6.0e-05
chronic rhinosinusitis 2.387 3.4e-03
cutaneous lupus erythematosus 5.500 5.3e-05
ductal carcinoma in situ 2.900 4.9e-02
Endometriosis -2.894 1.3e-02
head and neck cancer and chronic obstruc... 2.200 3.9e-03
interstitial cystitis 5.900 8.2e-04
juvenile dermatomyositis 1.291 1.2e-03
lung adenocarcinoma 2.000 3.2e-09
non-small cell lung cancer 2.915 4.6e-10
ovarian cancer 1.600 4.0e-02
periodontitis 1.300 6.9e-19
primary Sjogren syndrome 5.200 1.2e-06
psoriasis 2.100 6.6e-04
ulcerative colitis 5.000 1.7e-04

Synonym

Accession O43927
Symbols BLC
BCA1
ANGIE
BCA-1
BLR1L
ANGIE2
SCYB13

Gene

PDB

4ZAI   5CBA   5CBE  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (135)

AA Sequence

MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKK      1 - 70
NKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP                                    71 - 109
//

Text Mined References (148)

PMID Year Title