Property Summary

NCBI Gene PubMed Count 138
Grant Count 154
R01 Count 77
Funding $24,840,036.67
PubMed Score 533.09
PubTator Score 281.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
cutaneous lupus erythematosus 5.500 0.000
psoriasis 5.900 0.000
periodontitis 1.300 0.000
juvenile dermatomyositis 1.291 0.001
non-small cell lung cancer 2.915 0.000
interstitial cystitis 5.900 0.001
lung adenocarcinoma 3.300 0.000
adult high grade glioma 1.100 0.024
primary Sjogren syndrome 5.200 0.000
Endometriosis -2.894 0.013
breast carcinoma 1.500 0.000
Breast cancer 2.700 0.001
ductal carcinoma in situ 2.900 0.049
ulcerative colitis 5.000 0.000
ovarian cancer 1.600 0.040
chronic rhinosinusitis 2.387 0.003
head and neck cancer and chronic obstruc... 2.200 0.004

Synonym

Accession O43927
Symbols BLC
BCA1
ANGIE
BCA-1
BLR1L
ANGIE2
SCYB13

Gene

PDB

4ZAI   5CBA   5CBE  

Gene RIF (125)

PMID Text
26927848 was overexpressed in pulmonary vascular lesions of patients with IPAH and CTEPH, and increased serum concentrations were found in patients with IPAH and CTEPH, suggesting a potential pathogenic role of CXCL13 in both diseases.
26908875 Findings suggest the potential use of chemokine CXCL13 as a plasma biomarker of germinal centers (GCs) activity in vaccine trials and other clinical settings.
26752644 findings reveal a neuronal/astrocytic interaction in the spinal cord by which neuronally produced CXCL13 activates astrocytes via CXCR5 to facilitate neuropathic pain.
26517519 CXCL13 could be a potential biomarker for predicting recurrence in HBV-related hepatocellular carcinoma patients after hepatectomy.
26385705 Serum CXCL10 and CXCL13 levels may serve as clinical markers and contribute to the inflammatory response, especially skin manifestations thereof, in adult-onset Still's disease
26359802 Findings demonstrate a link between CXCL13 and primary Sjogren's syndrome disease activity and lymphoma.
26161394 CXCL13 plays an important role in the progression of hepatocellular carcinoma.
26121407 Aqueous humor concentration of CXCL13 is correlated with subfoveal choroidal thickness in normal subjects.
26116899 HIV-1 Vpr upregulates the gene expression of CXCL13 in human monocyte-derived dendritic cells
26109466 Gene encoding CXCL13 was identified as being upregulated and found to be negatively correlated with survival over 3-year follow-up period in Idiopathic pulmonary fibrosis.
More...

AA Sequence

MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKK      1 - 70
NKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP                                    71 - 109
//

Text Mined References (138)

PMID Year Title
26927848 2016 CXCL13 in idiopathic pulmonary arterial hypertension and chronic thromboembolic pulmonary hypertension.
26908875 2016 CXCL13 is a plasma biomarker of germinal center activity.
26752644 2016 CXCL13 drives spinal astrocyte activation and neuropathic pain via CXCR5.
26517519 2015 Phenotype and function of CXCR5+CD45RA-CD4+ T cells were altered in HBV-related hepatocellular carcinoma and elevated serum CXCL13 predicted better prognosis.
26385705 2015 Association of CXCL10 and CXCL13 levels with disease activity and cutaneous manifestation in active adult-onset Still's disease.
26359802 2015 CXCL13 and CCL11 Serum Levels and Lymphoma and Disease Activity in Primary Sjögren's Syndrome.
26161394 2015 The Effect of C-X-C Motif Chemokine 13 on Hepatocellular Carcinoma Associates with Wnt Signaling.
26121407 2016 ASSOCIATION BETWEEN AQUEOUS HUMOR CXC MOTIF CHEMOKINE LIGAND 13 LEVELS AND SUBFOVEAL CHOROIDAL THICKNESS IN NORMAL OLDER SUBJECTS.
26109466 2015 Molecular classification of idiopathic pulmonary fibrosis: personalized medicine, genetics and biomarkers.
26004159 2015 Cerebrospinal fluid CXCL13 in clinically isolated syndrome patients: Association with oligoclonal IgM bands and prediction of Multiple Sclerosis diagnosis.
More...