Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.98
PubTator Score 12.30

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.700 1.5e-03
Astrocytoma, Pilocytic -1.600 1.7e-05
atypical teratoid / rhabdoid tumor -2.100 1.4e-03
ependymoma -1.100 9.1e-04
glioblastoma -1.400 6.3e-05
lung carcinoma 2.200 4.2e-21
medulloblastoma -1.500 3.5e-03
medulloblastoma, large-cell -2.000 9.2e-03
ovarian cancer 1.100 2.4e-03
pituitary cancer -2.100 1.0e-09
psoriasis 1.600 5.3e-42

Gene RIF (12)

AA Sequence

MQCSWKAVLLLALASIAIQYTAIRTFTAKSFHTCPGLAEAGLAERLCEESPTFAYNLSRKTHILILATTR      1 - 70
SGSSFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDLLRSLYDCDLYFLENYIK     71 - 140
PPPVNHTTDRIFRRGASRVLCSRPVCDPPGPADLVLEEGDCVRKCGLLNLTVAAEACRERSHVAIKTVRV    141 - 210
PEVNDLRALVEDPRLNLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNLDVTQLTTVCEDFS    211 - 280
NSVSTGLMRPPWLKGKYMLVRYEDLARNPMKKTEEIYGFLGIPLDSHVARWIQNNTRGDPTLGKHKYGTV    281 - 350
RNSAATAEKWRFRLSYDIVAFAQNACQQVLAQLGYKIAASEEELKNPSVSLVEERDFRPFS             351 - 411
//

Text Mined References (20)

PMID Year Title