Property Summary

NCBI Gene PubMed Count 67
PubMed Score 203.53
PubTator Score 114.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 3.02034994971749E-28
non-small cell lung cancer 2798 2.56727226366594E-19
Duchenne muscular dystrophy 602 1.31653451771618E-11
juvenile dermatomyositis 1189 9.51691955572848E-9
limb girdle muscular dystrophy 2A 156 1.49708577266454E-8
pilocytic astrocytoma 3086 1.13654439510229E-6
lung cancer 4473 3.25619988775983E-6
ulcerative colitis 2087 3.93916552054781E-6
ovarian cancer 8492 7.12121765872016E-6
chronic lymphosyte leukemia 232 1.10815916118576E-5
medulloblastoma, large-cell 6234 3.89588514654503E-5
invasive ductal carcinoma 2950 4.81247955785723E-5
Becker muscular dystrophy 187 1.18769617930721E-4
glioblastoma 5572 2.37867916291242E-4
cutaneous lupus erythematosus 1056 3.98984133789223E-4
group 4 medulloblastoma 1875 0.00105773121276378
interstitial cystitis 2299 0.00111286857028908
lung adenocarcinoma 2714 0.00120439615467952
nasopharyngeal carcinoma 1056 0.00139350393773194
pancreatic cancer 2300 0.00229326363554683
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00260036619777123
head and neck cancer and chronic obstructive pulmonary disease 237 0.00328403002572801
osteosarcoma 7933 0.00347655622200844
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0041493306072248
primary pancreatic ductal adenocarcinoma 1271 0.00889372410880489
head and neck cancer 270 0.00911943243354254
dermatomyositis 967 0.0118425094223149
subependymal giant cell astrocytoma 2287 0.0142470295437963
mucosa-associated lymphoid tissue lymphoma 480 0.0142526751163212
astrocytoma 1493 0.0155667987293274
nephrosclerosis 329 0.0167471833249067
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0208789139015861
adrenocortical carcinoma 1427 0.0252892955225661
acute myeloid leukemia 785 0.02607245607309
gastric carcinoma 832 0.0477690016728192
Disease Target Count Z-score Confidence
Dementia 129 4.808 2.4
Osteopetrosis 40 3.942 2.0
Alzheimer's disease 644 3.211 1.6

Expression

Synonym

Accession O43914 A8K2X0 F5H389 Q6FGA5 Q9UMT3
Symbols DAP12
KARAP
PLOSL

Gene

PDB

2L35   2L34   4WO1   4WOL  

Gene RIF (40)

PMID Text
26642091 the microglial membrane adaptor protein DAP12 was required for both nerve injury- and intrathecal CSF1-induced upregulation of pain-related microglial genes and the ensuing pain, but not for microglial proliferation
26337043 Impaired signaling by the TREM2-DAP12 pathway leads to altered immune responses in phagocytosis, cytokine production, and microglial proliferation and survival, thus contributing to disease pathogenesis. Review.
26001891 The different expression of DAP12 compared to TREM2 represents the first description of such variable expressivity in Nasu-Hakola disease (NHD) microglia.
25957402 results support a role of DAP12 in stabilizing TREM2-CTF, thereby protecting against excessive pro-inflammatory responses.
25941351 T cells modified to express a KIR-CAR and DAP12 exhibit superior antitumor activity compared with standard first- and second-generation CD3zeta-based CARs in a xenograft model of mesothelioma highly resistant to immunotherapy.
25642940 isolated PMNs have an increased proportion of both TREM1 and DAP12 compared to normal healthy control
25487697 This study reveled that TYROBP having a central role in the bipolar disease and schizophrenia manifestation.
24935923 Data indicate that NKG2 receptor NKG2E was capable of associating with CD94 and DAP12 but that the complex was retained intracellularly at the endoplasmic reticulum.
24612676 Its mutation is a known genetic cause of Nasu-Hakola disease.
23810293 Macrophage traits in BRC cells facilitate the metastatic process and DAP12 expression might promote metastatic homing to bone and liver tissues.
More...

AA Sequence

MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPR      1 - 70
GRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK                                71 - 113
//

Text Mined References (73)

PMID Year Title
26642091 2016 Injured sensory neuron-derived CSF1 induces microglial proliferation and DAP12-dependent pain.
26337043 2015 TREM2 in CNS homeostasis and neurodegenerative disease.
26221034 2015 Identification and Characterization of CD300H, a New Member of the Human CD300 Immunoreceptor Family.
26001891 2015 Variable expression of microglial DAP12 and TREM2 genes in Nasu-Hakola disease.
25957402 2015 DAP12 Stabilizes the C-terminal Fragment of the Triggering Receptor Expressed on Myeloid Cells-2 (TREM2) and Protects against LPS-induced Pro-inflammatory Response.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25941351 2015 Generation of Potent T-cell Immunotherapy for Cancer Using DAP12-Based, Multichain, Chimeric Immunoreceptors.
25642940 2015 Inactivation of DAP12 in PMN inhibits TREM1-mediated activation in rheumatoid arthritis.
25487697 2015 Innate immune response is differentially dysregulated between bipolar disease and schizophrenia.
24935923 2014 Human NKG2E is expressed and forms an intracytoplasmic complex with CD94 and DAP12.
More...