Property Summary

NCBI Gene PubMed Count 21
Grant Count 11
R01 Count 9
Funding $2,432,420
PubMed Score 19.98
PubTator Score 12.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.149 0.003
group 4 medulloblastoma -1.600 0.000
lung carcinoma -2.100 0.000
spina bifida -1.182 0.032

Gene RIF (9)

PMID Text
25821985 Rab6A binding to KIF1C's motor domain represents an entirely new mode of regulation for a kinesin motor, and likely has important consequences for KIF1C's cellular functions.
25818806 The ability of exogenously expressed FEZ1 binding to kinesin-1 to promote early HIV-1 infection, leading to the movement of HIV-1 CA core to the nucleus
25344256 KIF1C translocation to the cell periphery intensifies and KIF1C accumulates both in the proximity of peripheral microtubules that show enrichment for the plus-tip-associated proteins CLASPs and around podosomes.
25151635 Microtubule acetylation influences the subcellular distribution of vesicles associated with the kinesin KIF1C, as well as their directionality, velocity and run length.
24808017 Identification of KIF1C as an hereditary spastic paraplegia gene supports the key role of intracellular trafficking processes in the pathogenesis of hereditary axonopathies.
24319291 Nonsense and missense mutations in the KIF1C gene associated with hereditary spastic paraparesis and cerebellar dysfunction.
23237952 findings show that the microtubule motor Kif1C contributes to persistent cell migration primarily through stabilization of an extended cell rearKif1C-mediated transport of alpha5beta1-integrins is required for the proper maturation of trailing focal adhesions and resistance to tail retraction
19996280 Data show that 4-oxo-4-HPR inhibited tubulin polymerization and modulated gene expression of spindle aberration associated genes Kif 1C, Kif 2A, Eg5, Tara, tankyrase-1, centractin, and TOGp.
16554367 Hairpin RNA-based depletion of KIF1C resulted in decreased podosome dynamics and ultimately in podosome deficiency.

AA Sequence

MAGASVKVAVRVRPFNARETSQDAKCVVSMQGNTTSIINPKQSKDAPKSFTFDYSYWSHTSTEDPQFASQ      1 - 70
QQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGRQEPGQQGIVPQLCEDLFSRVSENQSAQLSY     71 - 140
SVEVSYMEIYCERVRDLLNPKSRGSLRVREHPILGPYVQDLSKLAVTSYADIADLMDCGNKARTVAATNM    141 - 210
NETSSRSHAVFTIVFTQRCHDQLTGLDSEKVSKISLVDLAGSERADSSGARGMRLKEGANINKSLTTLGK    211 - 280
VISALADMQSKKRKSDFIPYRDSVLTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRTKQIRC    281 - 350
NAIINEDPNARLIRELQEEVARLRELLMAQGLSASALEGLKTEEGSVRGALPAVSSPPAPVSPSSPTTHN    351 - 420
GELEPSFSPNTESQIGPEEAMERLQETEKIIAELNETWEEKLRKTEALRMEREALLAEMGVAVREDGGTV    421 - 490
GVFSPKKTPHLVNLNEDPLMSECLLYHIKDGVTRVGQVDMDIKLTGQFIREQHCLFRSIPQPDGEVVVTL    491 - 560
EPCEGAETYVNGKLVTEPLVLKSGNRIVMGKNHVFRFNHPEQARLERERGVPPPPGPPSEPVDWNFAQKE    561 - 630
LLEQQGIDIKLEMEKRLQDLENQYRKEKEEADLLLEQQRLYADSDSGDDSDKRSCEESWRLISSLREQLP    631 - 700
PTTVQTIVKRCGLPSSGKRRAPRRVYQIPQRRRLQGKDPRWATMADLKMQAVKEICYEVALADFRHGRAE    701 - 770
IEALAALKMRELCRTYGKPDGPGDAWRAVARDVWDTVGEEEGGGAGSGGGSEEGARGAEVEDLRAHIDKL    771 - 840
TGILQEVKLQNSSKDRELQALRDRMLRMERVIPLAQDHEDENEEGGEVPWAPPEGSEAAEEAAPSDRMPS    841 - 910
ARPPSPPLSSWERVSRLMEEDPAFRRGRLRWLKQEQLRLQGLQGSGGRGGGLRRPPARFVPPHDCKLRFP    911 - 980
FKSNPQHRESWPGMGSGEAPTPLQPPEEVTPHPATPARRPPSPRRSHHPRRNSLDGGGRSRGAGSAQPEP    981 - 1050
QHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPPRMRRQRSAPDLKESGAAV                    1051 - 1103
//

Text Mined References (29)

PMID Year Title
25821985 2015 Rab6 regulation of the kinesin family KIF1C motor domain contributes to Golgi tethering.
25344256 2014 Podosome-regulating kinesin KIF1C translocates to the cell periphery in a CLASP-dependent manner.
25151635 2014 Microtubule acetylation regulates dynamics of KIF1C-powered vesicles and contact of microtubule plus ends with podosomes.
24808017 2014 Motor protein mutations cause a new form of hereditary spastic paraplegia.
24482476 2014 Exome sequencing links corticospinal motor neuron disease to common neurodegenerative disorders.
24319291 2014 KIF1C mutations in two families with hereditary spastic paraparesis and cerebellar dysfunction.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23237952 2012 Directional persistence of migrating cells requires Kif1C-mediated stabilization of trailing adhesions.
More...