Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.42
PubTator Score 0.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -2.400 5.7e-03
astrocytic glioma -1.400 1.7e-02
atypical teratoid / rhabdoid tumor -3.200 4.5e-04
Breast cancer 1.600 2.4e-02
cystic fibrosis -1.620 1.4e-03
ependymoma -2.500 5.5e-03
glioblastoma -1.900 8.8e-04
group 4 medulloblastoma -3.000 6.8e-04
interstitial cystitis -1.300 7.4e-03
lung adenocarcinoma -1.100 7.5e-10
lung cancer 2.100 1.6e-04
lung carcinoma 1.200 2.3e-05
medulloblastoma, large-cell -3.700 8.4e-04
oligodendroglioma -1.800 5.7e-03
osteosarcoma -1.278 7.5e-03
ovarian cancer -2.300 5.1e-15
Pick disease -1.200 3.2e-02
pituitary cancer 1.200 1.5e-03
tuberculosis -1.200 2.9e-05

Protein-protein Interaction (5)

Gene RIF (6)

AA Sequence

MLQWRRRHCCFAKMTWNAKRSLFRTHLIGVLSLVFLFAMFLFFNHHDWLPGRAGFKENPVTYTFRGFRST      1 - 70
KSETNHSSLRNIWKETVPQTLRPQTATNSNNTDLSPQGVTGLENTLSANGSIYNEKGTGHPNSYHFKYII     71 - 140
NEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGNESLAPGIQITRIFLLGLSIKLNGYLQRAILEESR    141 - 210
QYHDIIQQEYLDTYYNLTIKTLMGMNWVATYCPHIPYVMKTDSDMFVNTEYLINKLLKPDLPPRHNYFTG    211 - 280
YLMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDVYVGICLAK    281 - 350
LRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRK    351 - 420
LH                                                                        421 - 422
//

Text Mined References (10)

PMID Year Title