Property Summary

NCBI Gene PubMed Count 27
Grant Count 10
R01 Count 4
Funding $422,300.49
PubMed Score 7.70
PubTator Score 16.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Mucopolysaccharidosis 24 3.275 1.6

Expression

Gene RIF (9)

PMID Text
25138066 the relative expression of hyalurosome (CD44, HAS3, HB-EGF) genes was found to be reduced in patients prior to topical treatment and to be notably increased following treatment.
23549009 mutations of the HYAL3 gene are rare in Chinese lung squamous cell carcinoma patients and might contribute to lymph node metastasis
22960332 polymorphisms in HYAL3 are potentially involved in glaucomatous neurodegeneration.
20849597 Overexpression of HYAL3 is associated with colorectal cancer.
20849445 Nodular basal cell carcinoma is associated with increased levels of hyaluronic acid concomitant with upregulation of gene expression of HAS3, HYAL3 and RHAMM, when compared with normal adjacent skin.
20586096 Hyal3 null sperm showed delayed cumulus penetration and reduced acrosomal exocytosis.
12684632 Down-regulation of HYAL3 is associated with small cell lung cancer and glioma
12084718 Alternative mRNA splicing controls cellular expression of enzymatically active hyaluronidase.
11929860 Characterization of the murine hyaluronidase gene region reveals complex organization and cotranscription of Hyal1 with downstream genes, Fus2 and Hyal3.

AA Sequence

MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNALGIIANRGQHFHGQNM      1 - 70
TIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWG     71 - 140
RRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWH    141 - 210
SMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLP    211 - 280
VLAYVRLTHRRSGRFLSQDDLVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVT    281 - 350
RAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV       351 - 417
//

Text Mined References (27)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25138066 2014 Hyalurosome gene regulation and dose-dependent restoration of skin atrophy by retinaldehyde and defined-size hyaluronate fragments in dermatoporosis.
23549009 Analysis of HYAL3 gene mutations in Chinese lung squamous cell carcinoma patients.
22960332 2012 Genetic association and gene-gene interaction of HAS2, HABP1 and HYAL3 implicate hyaluronan metabolic genes in glaucomatous neurodegeneration.
21699545 Ultraviolet-B irradiation induces differential regulations of hyaluronidase expression and activity in normal human keratinocytes.
20849597 2010 Involvement of hyaluronidases in colorectal cancer.
20849445 2011 Nodular basal cell carcinoma is associated with increased hyaluronan homeostasis.
20586096 2010 Acidic hyaluronidase activity is present in mouse sperm and is reduced in the absence of SPAM1: evidence for a role for hyaluronidase 3 in mouse and human sperm.
18639473 Isoforms of hyaluronidases can be a predictor of a prostate cancer of good prognosis.
18390475 2008 Hyaluronidase expression and activity is regulated by pro-inflammatory cytokines in human airway epithelial cells.
More...