Property Summary

NCBI Gene PubMed Count 10
Grant Count 4
Funding $1,564,315.86
PubMed Score 11.50
PubTator Score 9.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
osteosarcoma 1.406 0.000
ependymoma -1.600 0.000
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
group 3 medulloblastoma -1.300 0.003
medulloblastoma, large-cell -1.200 0.000
lung cancer 1.300 0.000
Breast cancer 3.300 0.024
pediatric high grade glioma -1.400 0.000
subependymal giant cell astrocytoma -2.163 0.006
Pick disease -1.700 0.000
progressive supranuclear palsy -1.600 0.014
ovarian cancer -2.500 0.000

Synonym

Accession O43813
Symbols p40
GPR69A

Gene

PDB

3E6U   3E73  

Gene RIF (2)

PMID Text
22891245 Lanthionine synthetase C-like protein 1 interacts with and inhibits cystathionine beta-synthase: a target for neuronal antioxidant defense.
19528316 the crystal structures of human LanCL1, both free of and complexed with glutathione, revealing glutathione binding to a zinc ion at the putative active site formed by conserved GxxG motifs

AA Sequence

MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAV      1 - 70
LYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHL     71 - 140
NKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWY    141 - 210
QEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAP    211 - 280
GVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACK    281 - 350
FAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL                         351 - 399
//

Text Mined References (15)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22891245 2012 Lanthionine synthetase C-like protein 1 interacts with and inhibits cystathionine ?-synthase: a target for neuronal antioxidant defense.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19528316 2009 Structure of human lanthionine synthetase C-like protein 1 and its interaction with Eps8 and glutathione.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16979580 2006 Myristoylation of human LanC-like protein 2 (LANCL2) is essential for the interaction with the plasma membrane and the increase in cellular sensitivity to adriamycin.
15811525 2005 LANCL1, an erythrocyte protein recruited to the Maurer's clefts during Plasmodium falciparum development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...