Tbio | LanC-like protein 1 |
May play a role in EPS8 signaling. Binds glutathione.
This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008]
This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
ependymoma | 2514 | 2.43976956321003E-11 |
atypical teratoid / rhabdoid tumor | 4369 | 4.6896886056986E-8 |
ovarian cancer | 8492 | 4.75118319752168E-8 |
pediatric high grade glioma | 2712 | 7.50563142792679E-7 |
glioblastoma | 5572 | 3.97893966509688E-6 |
malignant mesothelioma | 3163 | 7.09446819379665E-6 |
medulloblastoma, large-cell | 6234 | 4.20986015279677E-5 |
Pick disease | 1893 | 4.46654624916408E-5 |
osteosarcoma | 7933 | 2.82835156504629E-4 |
lung cancer | 4473 | 3.15951796796797E-4 |
group 3 medulloblastoma | 2254 | 0.0027915983386021 |
subependymal giant cell astrocytoma | 2287 | 0.0059200740097653 |
progressive supranuclear palsy | 674 | 0.0137599338696858 |
Breast cancer | 3099 | 0.0238523710285762 |
Disease | log2 FC | p |
---|---|---|
malignant mesothelioma | -1.400 | 0.000 |
osteosarcoma | 1.406 | 0.000 |
ependymoma | -1.600 | 0.000 |
glioblastoma | -1.700 | 0.000 |
atypical teratoid / rhabdoid tumor | -1.900 | 0.000 |
group 3 medulloblastoma | -1.300 | 0.003 |
medulloblastoma, large-cell | -1.200 | 0.000 |
lung cancer | 1.300 | 0.000 |
Breast cancer | 3.300 | 0.024 |
pediatric high grade glioma | -1.400 | 0.000 |
subependymal giant cell astrocytoma | -2.163 | 0.006 |
Pick disease | -1.700 | 0.000 |
progressive supranuclear palsy | -1.600 | 0.014 |
ovarian cancer | -2.500 | 0.000 |
Accession | O43813 |
Symbols |
p40 GPR69A |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA Inparanoid |
Anole lizard | OMA Inparanoid |
Xenopus | OMA Inparanoid |
Zebrafish | OMA Inparanoid |
PMID | Text |
---|---|
22891245 | Lanthionine synthetase C-like protein 1 interacts with and inhibits cystathionine beta-synthase: a target for neuronal antioxidant defense. |
19528316 | the crystal structures of human LanCL1, both free of and complexed with glutathione, revealing glutathione binding to a zinc ion at the putative active site formed by conserved GxxG motifs |
MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAV 1 - 70 LYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHL 71 - 140 NKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWY 141 - 210 QEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAP 211 - 280 GVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACK 281 - 350 FAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL 351 - 399 //
PMID | Year | Title |
---|---|---|
23376485 | 2013 | Proteomic analysis of podocyte exosome-enriched fraction from normal human urine. |
22891245 | 2012 | Lanthionine synthetase C-like protein 1 interacts with and inhibits cystathionine ?-synthase: a target for neuronal antioxidant defense. |
21269460 | 2011 | Initial characterization of the human central proteome. |
19608861 | 2009 | Lysine acetylation targets protein complexes and co-regulates major cellular functions. |
19528316 | 2009 | Structure of human lanthionine synthetase C-like protein 1 and its interaction with Eps8 and glutathione. |
19413330 | 2009 | Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. |
18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. |
16979580 | 2006 | Myristoylation of human LanC-like protein 2 (LANCL2) is essential for the interaction with the plasma membrane and the increase in cellular sensitivity to adriamycin. |
15811525 | 2005 | LANCL1, an erythrocyte protein recruited to the Maurer's clefts during Plasmodium falciparum development. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
More... |