Property Summary

NCBI Gene PubMed Count 10
PubMed Score 11.50
PubTator Score 9.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.400 1.6e-04
atypical teratoid / rhabdoid tumor -1.900 4.7e-08
Breast cancer 3.300 2.4e-02
ependymoma -1.600 2.4e-11
glioblastoma -1.100 2.3e-05
group 3 medulloblastoma -1.300 2.8e-03
lung cancer 1.300 3.2e-04
malignant mesothelioma -1.400 7.1e-06
medulloblastoma, large-cell -1.200 4.2e-05
osteosarcoma 1.406 2.8e-04
ovarian cancer -2.500 4.8e-08
Pick disease -1.700 4.5e-05
progressive supranuclear palsy -1.600 1.4e-02
subependymal giant cell astrocytoma -2.163 5.9e-03

Gene RIF (2)

AA Sequence

MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAV      1 - 70
LYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHL     71 - 140
NKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWY    141 - 210
QEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAP    211 - 280
GVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACK    281 - 350
FAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL                         351 - 399
//

Text Mined References (15)

PMID Year Title