| Tbio | LanC-like protein 1 |
May play a role in EPS8 signaling. Binds glutathione.
This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008]
This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008]
Comments
Property Summary
| NCBI Gene PubMed Count | 10 |
| Grant Count | 4 |
| Funding | $1,564,315.86 |
| PubMed Score | 11.50 |
| PubTator Score | 9.92 |
| Disease | log2 FC | p |
|---|---|---|
| malignant mesothelioma | -1.400 | 0.000 |
| osteosarcoma | 1.406 | 0.000 |
| ependymoma | -1.600 | 0.000 |
| glioblastoma | -1.700 | 0.000 |
| atypical teratoid / rhabdoid tumor | -1.900 | 0.000 |
| group 3 medulloblastoma | -1.300 | 0.003 |
| medulloblastoma, large-cell | -1.200 | 0.000 |
| lung cancer | 1.300 | 0.000 |
| Breast cancer | 3.300 | 0.024 |
| pediatric high grade glioma | -1.400 | 0.000 |
| subependymal giant cell astrocytoma | -2.163 | 0.006 |
| Pick disease | -1.700 | 0.000 |
| progressive supranuclear palsy | -1.600 | 0.014 |
| ovarian cancer | -2.500 | 0.000 |
| PMID | Text |
|---|---|
| 22891245 | Lanthionine synthetase C-like protein 1 interacts with and inhibits cystathionine beta-synthase: a target for neuronal antioxidant defense. |
| 19528316 | the crystal structures of human LanCL1, both free of and complexed with glutathione, revealing glutathione binding to a zinc ion at the putative active site formed by conserved GxxG motifs |
MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAV 1 - 70 LYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHL 71 - 140 NKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWY 141 - 210 QEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAP 211 - 280 GVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACK 281 - 350 FAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL 351 - 399 //
| PMID | Year | Title |
|---|---|---|
| 23376485 | 2013 | Proteomic analysis of podocyte exosome-enriched fraction from normal human urine. |
| 22891245 | 2012 | Lanthionine synthetase C-like protein 1 interacts with and inhibits cystathionine ?-synthase: a target for neuronal antioxidant defense. |
| 21269460 | 2011 | Initial characterization of the human central proteome. |
| 19608861 | 2009 | Lysine acetylation targets protein complexes and co-regulates major cellular functions. |
| 19528316 | 2009 | Structure of human lanthionine synthetase C-like protein 1 and its interaction with Eps8 and glutathione. |
| 19413330 | 2009 | Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. |
| 18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. |
| 16979580 | 2006 | Myristoylation of human LanC-like protein 2 (LANCL2) is essential for the interaction with the plasma membrane and the increase in cellular sensitivity to adriamycin. |
| 15811525 | 2005 | LANCL1, an erythrocyte protein recruited to the Maurer's clefts during Plasmodium falciparum development. |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
| More... |
