Property Summary

NCBI Gene PubMed Count 14
Grant Count 5
R01 Count 5
Funding $646,686.5
PubMed Score 87.42
PubTator Score 12.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.915 0.002
Multiple myeloma 1.418 0.008
psoriasis 1.400 0.000
breast carcinoma 1.300 0.012
diabetes mellitus 2.000 0.004
Subcutaneous panniculitis-like T-cell ly... 1.900 0.045
ovarian cancer 1.400 0.009

Gene RIF (2)

PMID Text
22174317 HIV-1 Rev interacting protein, asparaginyl-tRNA synthetase (NARS), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NARS is decreased by RRE
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMW      1 - 70
HREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQ     71 - 140
GKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGL    141 - 210
APAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEG    211 - 280
GATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDL    281 - 350
LNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIP    351 - 420
EAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYK    421 - 490
REGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP                491 - 548
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...