Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.83
PubTator Score 3.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
invasive ductal carcinoma 2951 7.1e-05
ovarian cancer 8520 5.3e-04

Expression

  Differential Expression (2)

Disease log2 FC p
invasive ductal carcinoma 1.500 7.1e-05
ovarian cancer 1.200 5.3e-04

Gene RIF (1)

AA Sequence

MESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDACRY      1 - 70
GSAIGVLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTNPKDVLV     71 - 140
GADSVRAAITFSFFSIFSWGVLASLAYQRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQ    141 - 210
NAETTEGYQPPPVY                                                            211 - 224
//

Text Mined References (15)

PMID Year Title