Property Summary

NCBI Gene PubMed Count 40
Grant Count 55
R01 Count 36
Funding $6,234,857.49
PubMed Score 30.44
PubTator Score 24.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell -1.400 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.008
group 4 medulloblastoma 1.400 0.000
spina bifida -1.194 0.037
ovarian cancer 1.400 0.000

 GWAS Trait (1)

Gene RIF (32)

PMID Text
26317613 Vpu interacts with clathrin adaptors AP1G1 and AP2A1 in tetherin-expressing cells and this interaction is regulated by serine phosphorylation of Vpu and Vpu binding to BST2 (tetherin)
24843023 Vpu interacts with clathrin adaptors AP1G1 and AP2A1 in tetherin-expressing cells and this interaction is regulated by serine phosphorylation of Vpu and Vpu binding to BST2 (tetherin)
24006255 Interaction between Rab4b and AP1gamma allows the budding of clathrin-coated vesicles for subsequent traffic to recycling endosomes.
23705972 Vpu interacts with clathrin adaptors AP1G1 and AP2A1 in tetherin-expressing cells and this interaction is regulated by serine phosphorylation of Vpu and Vpu binding to BST2 (tetherin)
23678182 Vpu interacts with clathrin adaptors AP1G1 and AP2A1 in tetherin-expressing cells and this interaction is regulated by serine phosphorylation of Vpu and Vpu binding to BST2 (tetherin)
23077317 Vpu interacts with clathrin adaptors AP1G1 and AP2A1 in tetherin-expressing cells and this interaction is regulated by serine phosphorylation of Vpu and Vpu binding to BST2 (tetherin)
23077317 Vpu interacts with clathrin adaptors AP1G1 and AP2A1 in tetherin-expressing cells and this interaction is regulated by serine phosphorylation of Vpu and Vpu binding to BST2 (tetherin)
22345475 Vpu interacts with clathrin adaptors AP1G1 and AP2A1 in tetherin-expressing cells and this interaction is regulated by serine phosphorylation of Vpu and Vpu binding to BST2 (tetherin)
21762802 Vpu interacts with clathrin adaptors AP1G1 and AP2A1 in tetherin-expressing cells and this interaction is regulated by serine phosphorylation of Vpu and Vpu binding to BST2 (tetherin)
21762802 Vpu interacts with clathrin adaptors AP1G1 and AP2A1 in tetherin-expressing cells and this interaction is regulated by serine phosphorylation of Vpu and Vpu binding to BST2 (tetherin)
More...

AA Sequence

MPAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSSFREEDNTYRCRNVAKLLYMHMLGYPAHFGQLEC      1 - 70
LKLIASQKFTDKRIGYLGAMLLLDERQDVHLLMTNCIKNDLNHSTQFVQGLALCTLGCMGSSEMCRDLAG     71 - 140
EVEKLLKTSNSYLRKKAALCAVHVIRKVPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLA    141 - 210
HFRKLVPQLVRILKNLIMSGYSPEHDVSGISDPFLQVRILRLLRILGRNDDDSSEAMNDILAQVATNTET    211 - 280
SKNVGNAILYETVLTIMDIKSESGLRVLAINILGRFLLNNDKNIRYVALTSLLKTVQTDHNAVQRHRSTI    281 - 350
VDCLKDLDVSIKRRAMELSFALVNGNNIRGMMKELLYFLDSCEPEFKADCASGIFLAAEKYAPSKRWHID    351 - 420
TIMRVLTTAGSYVRDDAVPNLIQLITNSVEMHAYTVQRLYKAILGDYSQQPLVQVAAWCIGEYGDLLVSG    421 - 490
QCEEEEPIQVTEDEVLDILESVLISNMSTSVTRGYALTAIMKLSTRFTCTVNRIKKVVSIYGSSIDVELQ    491 - 560
QRAVEYNALFKKYDHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTSQANDLLD    561 - 630
LLGGNDITPVIPTAPTSKPSSAGGELLDLLGDINLTGAPAAAPAPASVPQISQPPFLLDGLSSQPLFNDI    631 - 700
AAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIV    701 - 770
PAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ                      771 - 822
//

Text Mined References (45)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24006255 2013 Rab4b controls an early endosome sorting event by interacting with the ?-subunit of the clathrin adaptor complex 1.
23632890 2013 LAMP1/CD107a is required for efficient perforin delivery to lytic granules and NK-cell cytotoxicity.
22511774 2012 BLOC-2, AP-3, and AP-1 proteins function in concert with Rab38 and Rab32 proteins to mediate protein trafficking to lysosome-related organelles.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19841138 2009 AP-1 and KIF13A coordinate endosomal sorting and positioning during melanosome biogenesis.
More...