Property Summary

NCBI Gene PubMed Count 19
Grant Count 30
R01 Count 19
Funding $4,228,998.48
PubMed Score 68.39
PubTator Score 51.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
osteosarcoma 1.012 0.001
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.500 0.000
primary pancreatic ductal adenocarcinoma 1.135 0.020
tuberculosis -1.500 0.000
Polycystic Ovary Syndrome -1.086 0.004
invasive ductal carcinoma -1.100 0.021
ovarian cancer -1.300 0.000

Gene RIF (4)

PMID Text
24966920 Cytohesin-3 was upregulated in hepatocellular carcinoma tissues, correlating with overall survival/relapse-free survival and tumor size/vascular invasion.
22454518 The PH domains of cytohesin 2/ARNO and cytohesin 3/GRP1 are responsible for the differential effects of these proteins on cell adhesion to fibronectin.
21932773 incorporation of the E345K charge reversal mutation into the GRP1 PH domain enhances PI(4,5)P(2) affinity 8-fold and yields constitutive plasma membrane targeting in cells
15878955 GRP1 is a new corepressor for thyroid hormone receptors, which modulates both positive and negative regulation by T3 by decreasing TR-complex formation on thyroid response elements

AA Sequence

MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQI      1 - 70
AMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDEFNIKVLQAFVELHEF     71 - 140
ADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVR    141 - 210
DKPTAERFIAMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVK    211 - 280
TWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGR    281 - 350
VVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK                        351 - 400
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24966920 2014 Cytohesin-3 is upregulated in hepatocellular carcinoma and contributes to tumor growth and vascular invasion.
23940353 2013 Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors.
22454518 2012 Phosphoinositide specificity determines which cytohesins regulate ?1 integrin recycling.
21932773 2011 The GRP1 PH domain, like the AKT1 PH domain, possesses a sentry glutamate residue essential for specific targeting to plasma membrane PI(3,4,5)P(3).
18084281 2008 GEP100 links epidermal growth factor receptor signalling to Arf6 activation to induce breast cancer invasion.
17398095 2007 The Arl4 family of small G proteins can recruit the cytohesin Arf6 exchange factors to the plasma membrane.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15878955 2005 General receptor for phosphoinositides 1, a novel repressor of thyroid hormone receptor action that prevents deoxyribonucleic acid binding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...