Property Summary

NCBI Gene PubMed Count 19
PubMed Score 69.10
PubTator Score 51.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 1.3e-04
invasive ductal carcinoma -1.100 2.1e-02
malignant mesothelioma 1.400 1.2e-05
medulloblastoma, large-cell -1.500 2.1e-05
osteosarcoma 1.012 1.2e-03
ovarian cancer -1.300 6.6e-06
Polycystic ovary syndrome -1.086 4.2e-03
primary pancreatic ductal adenocarcinoma 1.135 2.0e-02
tuberculosis -1.500 6.5e-07

Gene RIF (4)

AA Sequence

MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQI      1 - 70
AMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDEFNIKVLQAFVELHEF     71 - 140
ADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVR    141 - 210
DKPTAERFIAMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVK    211 - 280
TWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGR    281 - 350
VVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK                        351 - 400
//

Text Mined References (19)

PMID Year Title