Property Summary

NCBI Gene PubMed Count 24
PubMed Score 24.47
PubTator Score 17.46

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
colon cancer -1.300 3.5e-02
intraductal papillary-mucinous adenoma (... 2.700 3.8e-03
intraductal papillary-mucinous carcinoma... 1.500 5.0e-02
lung adenocarcinoma -1.100 7.4e-12
lung carcinoma -1.500 4.6e-10
malignant mesothelioma -2.100 9.3e-07
tuberculosis 1.600 4.7e-07

Synonym

Accession O43704 O15497 Q96FI1 Q9UK34 ST1B1
Symbols ST1B1
ST1B2
SULT1B2

Gene

PDB

2Z5F   3CKL  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKC      1 - 70
KRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSY     71 - 140
YHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIR    141 - 210
FLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAI    211 - 280
YETEMSKTALQFRTEI                                                          281 - 296
//

Text Mined References (24)

PMID Year Title