Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.99
PubTator Score 4.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Lupus Erythematosus, Systemic 67 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 9.5e-08
psoriasis 6694 4.5e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 1.0
Disease Target Count Z-score Confidence
Pre-Eclampsia 68 3.825 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.454 9.5e-08
psoriasis 1.900 4.5e-05

Gene RIF (6)

AA Sequence

MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLE      1 - 70
GADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVR     71 - 140
VMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHS    141 - 210
TNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNP    211 - 280
PAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGA    281 - 350
VWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISED    351 - 420
EQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK                                         421 - 453
//

Text Mined References (16)

PMID Year Title