Property Summary

NCBI Gene PubMed Count 13
Grant Count 11
R01 Count 6
Funding $810,718.47
PubMed Score 5.99
PubTator Score 4.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.900 0.000
osteosarcoma 1.454 0.000

Gene RIF (6)

PMID Text
23171684 Siglec-6 expression is increased in preterm preeclampsia placentas.
23089140 Siglec6 and leptin play a role in the aberrant properties characteristic of gestational trophoblastic disease, namely excess proliferation and invasion.
21880722 GdA interacts with Siglec-6 to suppress trophoblast invasiveness by down-regulating the ERK/c-Jun signaling pathway.
20237496 Observational study of gene-disease association. (HuGE Navigator)
18818296 Preeclampsia involves changes in the gene expression of SIGLEC6 in placental cytotrophoblasts.
17580316 the negative signaling potential of Siglec-6 may have a role in human-specific placental expression, to slow the tempo of the human birth process

AA Sequence

MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLE      1 - 70
GADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVR     71 - 140
VMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHS    141 - 210
TNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNP    211 - 280
PAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGA    281 - 350
VWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISED    351 - 420
EQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK                                         421 - 453
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23874842 2013 Differentially expressed genes in the pre-eclamptic placenta: a systematic review and meta-analysis.
23171684 2013 Siglec-6 expression is increased in placentas from pregnancies complicated by preterm preeclampsia.
23089140 2012 Siglec-6 is expressed in gestational trophoblastic disease and affects proliferation, apoptosis and invasion.
21880722 2011 Glycodelin-A protein interacts with Siglec-6 protein to suppress trophoblast invasiveness by down-regulating extracellular signal-regulated kinase (ERK)/c-Jun signaling pathway.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18818296 2009 Severe preeclampsia-related changes in gene expression at the maternal-fetal interface include sialic acid-binding immunoglobulin-like lectin-6 and pappalysin-2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17580316 2007 Human-specific expression of Siglec-6 in the placenta.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...