Property Summary

NCBI Gene PubMed Count 108
Grant Count 60
R01 Count 8
Funding $16,844,313.47
PubMed Score 257.85
PubTator Score 204.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 0.000

Gene RIF (92)

PMID Text
26982980 suggest that PSCA is a useful tissue marker for predicting biochemical recurrence in patients with high risk PC receiving NHT and radical prostatectomy
26785734 our data provide a novel molecular mechanism for the tumor suppressor role of PSCA
26554163 Studied six SNP loci: (rs2279115 of BCL2 gene, rs804270 of NEIL2 gene, rs909253 of LTA gene, rs2294008 of PSCA gene, rs3765524 and rs10509670 of PLCE1 gene) to evaluate gastric cancer risk using magnetic nanoparticles and universal tagged arrays.
26527100 analysis of PSCA level in the peripheral blood of PC patients who underwent radical prostatectomy shows it is related to a GADPH reference level (PSCA/GAPDH ratio)
26477693 PSCA has a promoting role in the growth and metastasis of prostate cancer.
26320491 Genetic Variants of PSCA Gene are not Associated with Colorectal Cancer.
26308216 PSCA rs2294008 Polymorphism is associated with Increased Risk of Cancer
26147638 we show that PSCA is a key player in nasopharyngeal carcinoma metastasis
26006239 These results suggest that PSCA gene variation has a potential effect on its expression and gastric adenocarcinoma risk in the Northwest Chinese population.
25964537 PSCA signaling may suppress tumor growth in vivo by modulating immunological characteristics of gallbladder cancer cells.
More...

AA Sequence

MKAVLLALLMAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNC      1 - 70
VDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL                      71 - 123
//

Text Mined References (109)

PMID Year Title
27098205 2016 Organization, evolution and functions of the human and mouse Ly6/uPAR family genes.
26982980 2016 Prostate Stem Cell Antigen Expression in Radical Prostatectomy Specimens Predicts Early Biochemical Recurrence in Patients with High Risk Prostate Cancer Receiving Neoadjuvant Hormonal Therapy.
26785734 2016 PSCA acts as a tumor suppressor by facilitating the nuclear translocation of RB1CC1 in esophageal squamous cell carcinoma.
26554163 2015 Genetic Variation of BCL2 (rs2279115), NEIL2 (rs804270), LTA (rs909253), PSCA (rs2294008) and PLCE1 (rs3765524, rs10509670) Genes and Their Correlation to Gastric Cancer Risk Based on Universal Tagged Arrays and Fe3O4 Magnetic Nanoparticles.
26527100 2015 The Quantified Level of Circulating Prostate Stem Cell Antigen mRNA relative to GAPDH Level Is a Clinically Significant Indictor for Predicting Biochemical Recurrence in Prostate Cancer Patients after Radical Prostatectomy.
26477693 2016 RNA interference targeting PSCA suppresses primary tumor growth and metastasis formation of human prostate cancer xenografts in SCID mice.
26320491 2015 Common Genetic Variants of PSCA, MUC1 and PLCE1 Genes are not Associated with Colorectal Cancer.
26308216 2015 PSCA rs2294008 Polymorphism with Increased Risk of Cancer.
26147638 2015 Down-regulation of prostate stem cell antigen (PSCA) by Slug promotes metastasis in nasopharyngeal carcinoma.
26006239 2015 The Influence of PSCA Gene Variation on Its Expression and Gastric Adenocarcinoma Susceptibility in the Northwest Chinese Population.
More...