Property Summary

NCBI Gene PubMed Count 64
Grant Count 13
R01 Count 9
Funding $622,209.64
PubMed Score 34.79
PubTator Score 32.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.020 0.005
glioblastoma 1.100 0.001
Breast cancer 2.800 0.024
ovarian cancer 1.200 0.003

 GWAS Trait (1)

Gene RIF (26)

PMID Text
27033705 Nck1 and Nck2 Interact with WTIP. Nck1/2 integrates nephrin with the Hippo kinase cascade through association with the adaptor protein WTIP.
26004008 Data suggest that PINCH1 and Nck2 critically participate in the regulation of cellular radiosensitivity and EGFR function and downstream signaling in a cellular model of human squamous cell carcinoma.
25482634 Tir-Intimin interaction recruits the Nck adaptor to a Tir tyrosine phosphorylated residue where it activates neural Wiskott-Aldrich syndrome protein (N-WASP).
24287595 Proteasomal degradation of Nck1 but not Nck2 regulates RhoA activation and actin dynamics.
24162774 HIV-1 gp120 downregulates the expression of NCK adaptor protein 2 (NCK2) in human B cells
23533358 NCK2 is involved in the susceptibility to opiates addiction.
23524290 The hNck2 SH3 domain also exhibited pH dependent monomer-dimer transition.
23349798 Data show that both HK2 and NCK2 are expressed in the retinal ganglion cell layer.
21992144 Nck2 effectively influences human melanoma phenotype progression.
21949127 p21-Activated kinase 3 (PAK3) protein regulates synaptic transmission through its interaction with the Nck2/Grb4 protein adaptor.
More...

AA Sequence

MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKNSLKKGSLVKN      1 - 70
LKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKFAYVAEREDELSLVKGSRVTV     71 - 140
MEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFLSLRKGASLSNGQGSRVLHVVQTLYPFSSVT    141 - 210
EEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRF    211 - 280
AGREWYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFH    281 - 350
TMDELVEHYKKAPIFTSEHGEKLYLVRALQ                                            351 - 380
//

Text Mined References (71)

PMID Year Title
27033705 2016 Nephrin Suppresses Hippo Signaling through the Adaptor Proteins Nck and WTIP.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26004008 2015 Targeting of the EGFR/?1 integrin connecting proteins PINCH1 and Nck2 radiosensitizes three-dimensional SCC cell cultures.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25482634 2014 Nck adaptors, besides promoting N-WASP mediated actin-nucleation activity at pedestals, influence the cellular levels of enteropathogenic Escherichia coli Tir effector.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24287595 2013 Proteasomal degradation of Nck1 but not Nck2 regulates RhoA activation and actin dynamics.
24058526 2013 Genome-wide meta-analysis of systolic blood pressure in children with sickle cell disease.
More...