Property Summary

NCBI Gene PubMed Count 44
Grant Count 188
R01 Count 101
Funding $22,310,340.23
PubMed Score 130.99
PubTator Score 32.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession O43609 D3DNX6 Q6PNE0 Spry-1
Symbols hSPRY1

Gene

PANTHER Protein Class (1)

Gene RIF (29)

PMID Text
26526994 Suppression of SPRY1 by age-associated methylation inhibits the replenishment of the muscle stem cell pool.
26075267 Cosuppression of Sprouty and Sprouty-related negative regulators of FGF signalling in prostate cancer
24932220 There is an inverse correlation between the expression of Spry1 and growth, proliferation, invasion and migration of ovarian cancer cells.
24604720 A random population of LNCaP prostate cancer cells comprises a heterogeneous group of cells with different androgen-deprivation sensitivities and potential for invasiveness; expression levels of 2 genes known to be regulated by miR-21, an androgen-regulated microRNA, SPRY1 and JAG1 were lower in an androgen insensitive clone, than an androgen sensitive clone.
24270409 The Spry1 acts as a sensor of mitogenic activity that not only attenuates RTK signaling but also induces a cellular senescence response to avoid uncontrolled proliferation.
23616430 Sprouty1 expression is not connected with mitogenic signaling and cell proliferation.
23554919 Spry1 and Spry4 have opposing roles in VSMC phenotypic modulation, and Spry1 maintains the VSMC differentiation phenotype in vitro in part through an Akt/FoxO/myocardin pathway.
23527175 Re-expression of SPRY1, a repressed target of BCL11B, limits the transformation capacity of Ewing sarcoma cells.
23469214 Feedback regulations of miR-21 and MAPKs via Pdcd4 and Spry1 are involved in arsenite-induced cell malignant transformation.
23441172 miR-21 promotes robust fibrogenic EMT of EMCs, in part by directly targeting PDCD4 and SPRY1.
More...

AA Sequence

MDPQNQHGSGSSLVVIQQPSLDSRQRLDYEREIQPTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPR      1 - 70
QEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSP     71 - 140
PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKCGECTAPRTLPSCLACNRQCLC    141 - 210
SAESMVEYGTCMCLVKGIFYHCSNDDEGDSYSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCL    211 - 280
KLCRRCYDWIHRPGCRCKNSNTVYCKLESCPSRGQGKPS                                   281 - 319
//

Text Mined References (45)

PMID Year Title
26526994 2015 Age-Associated Methylation Suppresses SPRY1, Leading to a Failure of Re-quiescence and Loss of the Reserve Stem Cell Pool in Elderly Muscle.
26075267 2015 Cosuppression of Sprouty and Sprouty-related negative regulators of FGF signalling in prostate cancer: a working hypothesis.
25416956 2014 A proteome-scale map of the human interactome network.
24932220 2014 The expression of the Sprouty 1 protein inversely correlates with growth, proliferation, migration and invasion of ovarian cancer cells.
24797007 2014 Genome-wide association study identifies two novel genomic regions in irritable bowel syndrome.
24604720 2014 Correlation of Sprouty1 and Jagged1 with aggressive prostate cancer cells with different sensitivities to androgen deprivation.
24270409 2014 Sprouty1 induces a senescence-associated secretory phenotype by regulating NF?B activity: implications for tumorigenesis.
23616430 2014 In non-small cell lung cancer mitogenic signaling leaves Sprouty1 protein levels unaffected.
23554919 2013 Spry1 and Spry4 differentially regulate human aortic smooth muscle cell phenotype via Akt/FoxO/myocardin signaling.
23527175 2013 BCL11B is up-regulated by EWS/FLI and contributes to the transformed phenotype in Ewing sarcoma.
More...