Property Summary

NCBI Gene PubMed Count 47
PubMed Score 141.22
PubTator Score 32.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma -1.030 1.9e-02
adult high grade glioma 1.300 6.7e-03
Astrocytoma, Pilocytic 1.700 1.5e-06
atypical teratoid / rhabdoid tumor 2.300 1.4e-05
Breast cancer -1.500 6.9e-08
breast carcinoma -1.100 6.4e-22
glioblastoma 2.000 4.0e-07
intraductal papillary-mucinous adenoma (... -1.300 2.8e-02
intraductal papillary-mucinous carcinoma... -1.200 3.4e-02
malignant mesothelioma -3.400 5.7e-09
ovarian cancer -2.100 1.1e-05
psoriasis -1.900 6.0e-05
Rheumatoid arthritis 2.700 2.2e-02
tuberculosis -1.400 8.5e-04

Synonym

Accession O43609 D3DNX6 Q6PNE0 Spry-1
Symbols hSPRY1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Protein-protein Interaction (1)

Gene RIF (32)

AA Sequence

MDPQNQHGSGSSLVVIQQPSLDSRQRLDYEREIQPTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPR      1 - 70
QEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSP     71 - 140
PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKCGECTAPRTLPSCLACNRQCLC    141 - 210
SAESMVEYGTCMCLVKGIFYHCSNDDEGDSYSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCL    211 - 280
KLCRRCYDWIHRPGCRCKNSNTVYCKLESCPSRGQGKPS                                   281 - 319
//

Text Mined References (48)

PMID Year Title