Property Summary

NCBI Gene PubMed Count 80
Grant Count 179
R01 Count 101
Funding $19,499,926.49
PubMed Score 886.44
PubTator Score 294.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession O43602 A6NFY6 A9Z1V8 D3DUY8 D3DUY9 D3DUZ0 O43911 Q5JYZ5
Symbols DC
DBCN
LISX
SCLH
XLIS

Gene

DCX

PDB

1MJD   2BQQ   2XRP   4ATU   5IKC   5IN7   5IO9   5IOI   5IP4  

Gene RIF (41)

PMID Text
26498952 In high-risk metastatic Neuroblastoma, TH and DCX mRNA quantification could be used for the assessment of response to treatment and for early detection of progressive disease or relapses.
25817838 Results point to a critical role of doublecortin in the formation of the neuromuscular junctions.
25760044 HIV-1 Tat induces hyperphosphorylation of neuronal migration protein doublecortin in neuronal cells
25283777 It was conclude that microtubule ends have two distinct features that proteins can recognize independently, namely a structural feature related to curvature and nucleotide state.
24945770 in utero doublecortin knockdown, but not knockout, shows a neocortical neuronal migration phenotype.
24758934 human DCX protein was expressed in human adipose stem cells, collagen II was decreased while aggrecan, matrilin 2, and GDF5 were increased during the 14-day pellet culture.
24288185 DCX-positive cells occur in a wide range of hypothalamic nuclei in humans, mice and sheep.
24034596 We propose that DCDC2 is a tumor suppressor gene of HCC.
23846421 coexpression of DCX and SPARC collaboratively diminished radioresistance of glioma cells.
23667508 DCX is dispensable for the development of new neurons in adult mice
More...

AA Sequence

MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVY      1 - 70
AVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTK     71 - 140
NVNPNWSVNVKTSANMKAPQSLASSNSAQARENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQV    141 - 210
LTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSA    211 - 280
TAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLY    281 - 350
LPLSLDDSDSLGDSM                                                           351 - 365
//

Text Mined References (80)

PMID Year Title
27292316 2016 A novel DCX missense mutation in a family with X-linked lissencephaly and subcortical band heterotopia syndrome inherited from a low-level somatic mosaic mother: Genetic and functional studies.
26498952 2016 TH and DCX mRNAs in peripheral blood and bone marrow predict outcome in metastatic neuroblastoma patients.
25817838 2015 A critical and previously unsuspected role for doublecortin at the neuromuscular junction in mouse and human.
25416956 2014 A proteome-scale map of the human interactome network.
25283777 2014 Doublecortin recognizes the longitudinal curvature of the microtubule end and lattice.
24945770 2014 Off-target effect of doublecortin family shRNA on neuronal migration associated with endogenous microRNA dysregulation.
24758934 2014 Doublecortin may play a role in defining chondrocyte phenotype.
24607389 2014 Mutations in USP9X are associated with X-linked intellectual disability and disrupt neuronal cell migration and growth.
24288185 2014 DCX-expressing cells in the vicinity of the hypothalamic neurogenic niche: a comparative study between mouse, sheep, and human tissues.
24034596 2013 Detection of doublecortin domain-containing 2 (DCDC2), a new candidate tumor suppressor gene of hepatocellular carcinoma, by triple combination array analysis.
More...