Property Summary

NCBI Gene PubMed Count 83
PubMed Score 946.26
PubTator Score 294.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Classical Lissencephalies and Subcortical Band Heterotopias 4 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.000 2.3e-02
Breast cancer -1.700 7.5e-03
ependymoma -1.300 1.4e-02
group 3 medulloblastoma 3.500 2.9e-04
invasive ductal carcinoma -2.092 6.6e-03
lung carcinoma 3.500 1.7e-49
oligodendroglioma 2.200 7.0e-03
ovarian cancer -2.100 1.2e-08
Pick disease 1.700 3.7e-03
pituitary cancer 3.300 5.1e-11
primitive neuroectodermal tumor 2.700 4.0e-03
progressive supranuclear palsy 1.600 9.1e-03

Gene RIF (45)

AA Sequence

MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVY      1 - 70
AVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTK     71 - 140
NVNPNWSVNVKTSANMKAPQSLASSNSAQARENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQV    141 - 210
LTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSA    211 - 280
TAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLY    281 - 350
LPLSLDDSDSLGDSM                                                           351 - 365
//

Text Mined References (83)

PMID Year Title